PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_23300V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 342aa    MW: 36618.6 Da    PI: 7.5709
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_23300V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1214.3e-3853111260
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                         + k ++cprC+s+ntkfCyynnys++qPr+fC++C+ryWt+GG+lrnvPvGgg+rk+ +
  Pp3c17_23300V3.1.p  53 PAKVIPCPRCESMNTKFCYYNNYSVTQPRHFCRQCQRYWTAGGTLRNVPVGGGSRKKSR 111
                         568899**************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2351108IPR003851Zinc finger, Dof-type
PfamPF027018.9E-3355111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.51857111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MQLPGHQNDS AALIGSKPQC SPNAALSGGS DAPASPSSPG SPTKIANATR EKPAKVIPCP  60
RCESMNTKFC YYNNYSVTQP RHFCRQCQRY WTAGGTLRNV PVGGGSRKKS RHPRGGAAEP  120
YLQRAGSYGV ASAGEHSIMQ NVGFQQMLTQ DMVGLNFAQL PGFVPPNTHH YVPCSMDHSD  180
GVYAPMTNKP PGQEDLSNLN VLYGTAPMGG YYPAPEMGGE NSGNAVKPEF WATSMAAPRV  240
VVPGSNPSRD GRLDSSMLLN LGLNNRSPTQ GGGNGKPMWD HQDLKPALPQ QKNGSPPHGS  300
STIEEEGSTP TNGYSNNRYE EGDTVSSMWH DMQHDLDNIF Q*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.135320.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024400213.10.0dof zinc finger protein 1-like
TrEMBLA0A2K1J5720.0A0A2K1J572_PHYPA; Uncharacterized protein
STRINGPP1S68_214V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69570.12e-30Dof family protein