PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_18190V3.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 314aa    MW: 35668.5 Da    PI: 4.5821
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_18190V3.5.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74.2e-1862114456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++++ +q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c17_18190V3.5.p  62 KRRLSFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWK 114
                         4578889*********************************************9 PP

2HD-ZIP_I/II122.12.8e-3960152193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls +qv++LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+k kqlE+dye+L + y++lk++ e++ k++++L++e+
  Pp3c17_18190V3.5.p  60 EKKRRLSFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKIKQLERDYETLTQDYNRLKSDFEAVLKDKKNLKDEV 150
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Pp3c17_18190V3.5.p 151 NR 152
                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.13E-1940117IPR009057Homeodomain-like
PROSITE profilePS5007117.256116IPR001356Homeobox domain
SMARTSM003892.4E-1459120IPR001356Homeobox domain
CDDcd000861.74E-1561117No hitNo description
PfamPF000461.9E-1562114IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.603.9E-1968114IPR009057Homeodomain-like
PRINTSPR000315.3E-68796IPR000047Helix-turn-helix motif
PROSITE patternPS00027091114IPR017970Homeobox, conserved site
PRINTSPR000315.3E-696112IPR000047Helix-turn-helix motif
PfamPF021837.2E-16116156IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MIEEGFQILQ EIVPRSLGDL EDMSAGCGQK RPYYAAYENH SSEEPEDVDE GVDEFSHHVE  60
KKRRLSFDQV RSLERNFEVE NKLEPERKMQ LAKELGLQPR QVAVWFQNRR ARWKIKQLER  120
DYETLTQDYN RLKSDFEAVL KDKKNLKDEV NRLKGITTEE EKNVDASEPT QCSSQPASPA  180
QSEKSDIVTS KVRSTPTIDV LPGAAKEPNE RSVKRTMSSD SYSSDVMDAE SPRTGDSSNP  240
NLPTDAPWVQ YHHPQFPPES FVGPTPNPQL AGVGDTLSLQ VKLEEMAGFP TDQAFLLSQL  300
ENQTVLPNWW DWA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1108116RRARWKIKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.159650.0gametophore
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0280801e-42AB028080.2 Physcomitrella patens mRNA for homeobox protein PpHB9, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401472.10.0homeobox-leucine zipper protein HAT5-like isoform X1
TrEMBLA0A2K1J4G30.0A0A2K1J4G3_PHYPA; Uncharacterized protein
STRINGPP1S65_52V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-39homeobox protein 16