PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_18190V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 345aa    MW: 38849.2 Da    PI: 4.8395
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_18190V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.9e-1893145456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++++ +q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c17_18190V3.1.p  93 KRRLSFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWK 145
                         4578889*********************************************9 PP

2HD-ZIP_I/II121.83.4e-3991183193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls +qv++LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+k kqlE+dye+L + y++lk++ e++ k++++L++e+
  Pp3c17_18190V3.1.p  91 EKKRRLSFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKIKQLERDYETLTQDYNRLKSDFEAVLKDKKNLKDEV 181
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Pp3c17_18190V3.1.p 182 NR 183
                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.99E-1971148IPR009057Homeodomain-like
PROSITE profilePS5007117.287147IPR001356Homeobox domain
SMARTSM003892.4E-1490151IPR001356Homeobox domain
CDDcd000867.43E-1692148No hitNo description
PfamPF000462.2E-1593145IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-1999145IPR009057Homeodomain-like
PRINTSPR000316.2E-6118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000316.2E-6127143IPR000047Helix-turn-helix motif
PfamPF021838.2E-16147187IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009637Biological Processresponse to blue light
GO:0030308Biological Processnegative regulation of cell growth
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048573Biological Processphotoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MAVVSLGPYG GQSLNMLMQR NDHRADTLVA MLGSCSPHMA LQQVPRSLGD LEDMSAGCGQ  60
KRPYYAAYEN HSSEEPEDVD EGVDEFSHHV EKKRRLSFDQ VRSLERNFEV ENKLEPERKM  120
QLAKELGLQP RQVAVWFQNR RARWKIKQLE RDYETLTQDY NRLKSDFEAV LKDKKNLKDE  180
VNRLKGITTE EEKNVDASEP TQCSSQPASP AQSEKSDIVT SKVRSTPTID VLPGAAKEPN  240
ERSVKRTMSS DSYSSDVMDA ESPRTGDSSN PNLPTDAPWV QYHHPQFPPE SFVGPTPNPQ  300
LAGVGDTLSL QVKLEEMAGF PTDQAFLLSQ LENQTVLPNW WDWA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKIKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.159650.0gametophore
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00051PBMTransfer from AT4G40060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0280801e-42AB028080.2 Physcomitrella patens mRNA for homeobox protein PpHB9, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401472.10.0homeobox-leucine zipper protein HAT5-like isoform X1
TrEMBLA0A2K1J4G30.0A0A2K1J4G3_PHYPA; Uncharacterized protein
STRINGPP1S65_52V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.14e-39homeobox protein 16