PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_18130V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 351aa    MW: 38472.7 Da    PI: 4.7484
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_18130V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-1893145456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++++ +q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c17_18130V3.1.p  93 KRRLSFDQVRSLERSFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWK 145
                         4578889*********************************************9 PP

2HD-ZIP_I/II119.61.6e-3891183193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls +qv++LE+sFe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlE+dye+L + y +lk++ e+  +e++ L++e+
  Pp3c17_18130V3.1.p  91 EKKRRLSFDQVRSLERSFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKTKQLERDYEMLNSGYIKLKADFETALREKDVLKAEV 181
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Pp3c17_18130V3.1.p 182 QR 183
                         86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.1E-2070148IPR009057Homeodomain-like
SuperFamilySSF466897.1E-2075149IPR009057Homeodomain-like
PROSITE profilePS5007117.6787147IPR001356Homeobox domain
SMARTSM003892.6E-1590151IPR001356Homeobox domain
CDDcd000865.16E-1792148No hitNo description
PfamPF000461.3E-1593145IPR001356Homeobox domain
PRINTSPR000316.4E-6118127IPR000047Helix-turn-helix motif
PROSITE patternPS000270122145IPR017970Homeobox, conserved site
PRINTSPR000316.4E-6127143IPR000047Helix-turn-helix motif
PfamPF021834.6E-15147188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MAMAATGLSS FGGQNVMLMR NDMGSSNSLV AMLNSCNPHV SFQVSRLGGG LEDAIAGCGQ  60
KRPFFPTFGN GPGEEPEDGD DGGDDGSQPV EKKRRLSFDQ VRSLERSFEV ENKLEPERKM  120
QLAKELGLQP RQVAVWFQNR RARWKTKQLE RDYEMLNSGY IKLKADFETA LREKDVLKAE  180
VQRLSGKTSP QGSQSSQSAD SSQCESDSHC MPDTEESPKL GKKPYNLAIT KDHHHTRSSP  240
TMTVCSTPKL EVEKTSTSSG SNSSDLLDAD SPHTSDSNPS DEEKLACCSQ FPPPESLVGP  300
LGVDDDVNAS QQSFPVKLEE GCHAFQVDPN CGYFFAPAVE QSVLPWWDWP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139147RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.84250.0gametophore| protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401525.10.0homeobox-leucine zipper protein HOX20-like
TrEMBLA0A2K1J4G00.0A0A2K1J4G0_PHYPA; Uncharacterized protein
STRINGPP1S65_42V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.15e-38homeobox 1