PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_16910V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 800aa    MW: 87240.4 Da    PI: 6.1002
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_16910V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.12.3e-21113168156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t+ q++e+e lF+++++p+ ++r++L++ lgL+ rqVk+WFqNrR+++k
  Pp3c17_16910V3.4.p 113 KKRYHRHTPRQIQEMEMLFKECPHPDDKQRQQLSRDLGLEPRQVKFWFQNRRTQMK 168
                         688999***********************************************998 PP

2START212.31.8e-663085311206
                         HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....E CS
               START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....k 78 
                         ela +a++elv++a+ eep+Wv +     e++n++e++++f+++ +      ++ea r++++v m+ ++lve+l+d   qW  +++    +
  Pp3c17_16910V3.4.p 308 ELAVTAMEELVRMAQTEEPLWVNMGevgkEQLNYEEYMRQFPRGIGmcppgLKTEATRETALVMMNGVNLVETLMDAT-QWMDMFPcivsR 397
                         57899*******************99*****************999********************************.************ PP

                         EEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEE CS
               START  79 aetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghs 162
                         a t++v+ +g      galqlm+aelq+lsplvp R+ +f+Ry++q+ +g+w++vdvSvds +++p  +s++R++++pSg li++++ng+ 
  Pp3c17_16910V3.4.p 398 ALTVDVLATGvtgnrnGALQLMYAELQVLSPLVPtREIYFLRYCKQHAEGVWAVVDVSVDSLRDNP-PPSLMRCRRRPSGVLIQDTPNGYA 487
                         ******************************************************************.7*********************** PP

                         EEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 163 kvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         kvt veh+++++r +h ++r lv++g+a+ga++w+atlqrqce+
  Pp3c17_16910V3.4.p 488 KVTCVEHMEYDDRAVHRMYRDLVNTGMAFGAQRWLATLQRQCER 531
                         ******************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.43E-2096170IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-2296151IPR009057Homeodomain-like
PROSITE profilePS5007117.184110170IPR001356Homeobox domain
SMARTSM003891.1E-19111174IPR001356Homeobox domain
CDDcd000864.67E-19112170No hitNo description
PfamPF000466.0E-19113168IPR001356Homeobox domain
PROSITE patternPS000270145168IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.604.0E-4152198IPR009057Homeodomain-like
PROSITE profilePS5084846.607299534IPR002913START domain
SuperFamilySSF559615.42E-38300533No hitNo description
CDDcd088751.55E-134303530No hitNo description
SMARTSM002344.5E-60308531IPR002913START domain
PfamPF018522.2E-56309531IPR002913START domain
Gene3DG3DSA:3.30.530.201.3E-4410529IPR023393START-like domain
SuperFamilySSF559615.77E-25553790No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 800 aa     Download sequence    Send to blast
MRLGGVTVQV PPNGNLGNLG RSFGELGGMP AGAMAPPRQI PPLAMPRPPP KHYSSPSLSL  60
GPPTGLDGQR EVSQTADNEQ QQKNKEEYES RSGSDNMEGG SGDEDPDNNH PRKKRYHRHT  120
PRQIQEMEML FKECPHPDDK QRQQLSRDLG LEPRQVKFWF QNRRTQMKAQ TERAENSMLR  180
SENEKLRSEN LIMREALKNP QCPHCGGPAT VGEMTFDEQQ LRIENVRLKE ELDRVSALAA  240
KYLGRPITPM APLALPSSSL DLQVGGGSSF GGMHPAPGNL DVVAGPSVAD VATRPGGLTE  300
AEKPMVVELA VTAMEELVRM AQTEEPLWVN MGEVGKEQLN YEEYMRQFPR GIGMCPPGLK  360
TEATRETALV MMNGVNLVET LMDATQWMDM FPCIVSRALT VDVLATGVTG NRNGALQLMY  420
AELQVLSPLV PTREIYFLRY CKQHAEGVWA VVDVSVDSLR DNPPPSLMRC RRRPSGVLIQ  480
DTPNGYAKVT CVEHMEYDDR AVHRMYRDLV NTGMAFGAQR WLATLQRQCE RLASLLASNI  540
ASRDLGGVPS ASGRRSMLKL AQRMTNNFCA GVSASTVHTW TTLSGSGDDD VRVMTRKSVD  600
NPGEPHGIVL SAATSMWLPV SPARVFQFLR DERLRSEWDI LSNGGMVTEM AHIAKGQDPG  660
NSVSLLRVNA MNSSQSNMLI LQESCTDVSG SLVIYAPVDI PAMNLVLQGG DPAYVALLPS  720
GFAILPDGPG GDRGALGNEQ GGQLTEIGRG TGSLLTVAFQ ILVSSIPSAR LSLESVATVN  780
NLISCTVQRI RSALLVEDA*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in the layer 1 (L1) of shoot meristems. {ECO:0000269|PubMed:12505995}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401280.10.0homeobox-leucine zipper protein PROTODERMAL FACTOR 2-like
RefseqXP_024401281.10.0homeobox-leucine zipper protein PROTODERMAL FACTOR 2-like
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLQ147S60.0Q147S6_PHYPA; Class IV HD-Zip protein HDZ41
STRINGPP1S173_90V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Prigge MJ,Clark SE
    Evolution of the class III HD-Zip gene family in land plants.
    Evol. Dev., 2006 Jul-Aug. 8(4): p. 350-61
    [PMID:16805899]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]