PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_16170V3.1.p
Common NamePHYPADRAFT_100669
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family B3
Protein Properties Length: 579aa    MW: 64604.6 Da    PI: 9.8107
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_16170V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B352.58.8e-1749141198
                         EEEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE....EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
                  B3   1 ffkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy..rkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                         f+k++ ++ + k + l +p +f+++   +++ +kt++le +s ++W+v++ +  + ++++  +++GW++Fvk+++L+ gD + F+l+++s 
  Pp3c17_16170V3.1.p  49 FLKKM-TEVAIK-SKLQMPVSFVRNS--VTRIGKTIILEGPSTNKWSVEV-WpgSVQKRSLEFRDGWQKFVKDHNLQIGDQLCFTLTSDSH 134
                         66777.444444.45999*****544..567999****************.66666667799************************99999 PP

                         E..EEEEE- CS
                  B3  90 felvvkvfr 98 
                         f   v+v++
  Pp3c17_16170V3.1.p 135 F--QVMVYD 141
                         9..666665 PP

2B358.41.3e-18293386499
                         E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                  B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                         v+t+++v k  ++vl k f ++h+  ++es+++tl ++ g sW vk  ++ + ++  +++GW++F+ +n+L+e D++vF++++++ f  +v
  Pp3c17_16170V3.1.p 293 VMTKAYVYKGFWMVLNKVFSNAHM--PHESREVTLCNKAGHSWPVKWLFKTTTNSSGFSGGWRGFALDNRLEESDVCVFEMVDEKYFVILV 381
                         7899***************99997..55888******************99999999***********************9999***9999 PP

                         EEE-S CS
                  B3  95 kvfrk 99 
                         ++fr+
  Pp3c17_16170V3.1.p 382 HLFRA 386
                         99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.12E-2146143IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086313.28147143IPR003340B3 DNA binding domain
CDDcd100179.18E-2147141No hitNo description
Gene3DG3DSA:2.40.330.102.4E-2047144IPR015300DNA-binding pseudobarrel domain
PfamPF023624.6E-1449140IPR003340B3 DNA binding domain
SMARTSM010193.1E-749143IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.0E-20286385IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019366.87E-24287387IPR015300DNA-binding pseudobarrel domain
CDDcd100174.83E-24288385No hitNo description
SMARTSM010196.3E-17290387IPR003340B3 DNA binding domain
PROSITE profilePS5086313.084290387IPR003340B3 DNA binding domain
PfamPF023628.1E-17292386IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 579 aa     Download sequence    Send to blast
METKACTVCS MNCLKLHGDE DEDADRNKRM LDSSRGRKKD AASHLLPSFL KKMTEVAIKS  60
KLQMPVSFVR NSVTRIGKTI ILEGPSTNKW SVEVWPGSVQ KRSLEFRDGW QKFVKDHNLQ  120
IGDQLCFTLT SDSHFQVMVY DESGSQKASA MDAINSTVTI KHEPKHLSKV RSDVRTKGPE  180
ARLKQKVTKR IRIKSAVKPT VVVVHSSDSE LGNSEPPEKD ENLKEIISKE KIQDCPGMDG  240
SLADPKPLLA PHILQGGHVV SQRRSVTPAE KERALNAARD LADTLTNPKL VMVMTKAYVY  300
KGFWMVLNKV FSNAHMPHES REVTLCNKAG HSWPVKWLFK TTTNSSGFSG GWRGFALDNR  360
LEESDVCVFE MVDEKYFVIL VHLFRAIGQP SEDAGDYRPS PGRGRNANRR KRKAIDSPLD  420
TRCTKIKLFH SGDLKSPAGC SRAKYLYHTQ SQEAENLAQM VGCSQKQQKD TCTASHGKVL  480
HQDEGKEVTS TAITSSCDTD FTSDNPSSEA LETFERRTAL QIRPLHAFQF PRRKTGSFRD  540
YLMDLGKELV GQQAAMAAPK RSSPPASRKT QISPSLEV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A1e-1726138522141B3 domain-containing transcription factor VRN1
4i1k_B1e-1726138522141B3 domain-containing transcription factor VRN1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024400344.10.0B3 domain-containing protein Os11g0197600-like
TrEMBLA0A2K1J4490.0A0A2K1J449_PHYPA; Uncharacterized protein
STRINGPP1S434_19V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.13e-24B3 family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]