PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c17_13550V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 817aa    MW: 90944 Da    PI: 5.4776
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c17_13550V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS376.33.9e-1154408082373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cA+av++g++  a++l+++l+e++s +g+  qR+a+yf+eAL a++++++ +ly+al+ ++ s   +++ l+al lf e +P+++
  Pp3c17_13550V3.2.p 440 TNLLIRCAHAVEQGNFGYANELINELREHSSAYGNGRQRMAHYFVEALVAKMSGTGGQLYSALSNNRPS---EAQMLKALMLFCEHCPFIQ 527
                         789************************************************************999888...899999************* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         + h+ aN+ I+ea++g++rvHiiD++i +G+QWp+Ll +L++Rpegpp+lRiTg+++p++g   + +++ tg+rLak+A+++gvpf+f++ 
  Pp3c17_13550V3.2.p 528 VPHIFANHSIVEAFKGASRVHIIDYGILYGVQWPCLLYQLSTRPEGPPHLRITGIDRPQPGfrPSARIQDTGRRLAKLAKKMGVPFKFHA- 617
                         **************************************************************9***************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +a+++e++++ +L ++++E+laVn++++  +lldesv+ +s+r+ vL+ +ksl+Pkv+v    +a +n++ F+ rf eal+++s++fd++e
  Pp3c17_13550V3.2.p 618 IAEKWEAITPAHLLLREDEVLAVNCMFRFRHLLDESVTAASPRNLVLSRIKSLNPKVFVQGVFNAGYNAPFFMSRFREALSHFSTIFDAME 708
                         7****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         +++p+++ +r+ +++e++grei nvvaceg er+er+et+++W++r ++aGF+++p s ++++++k+ +r ++ d y v ++ +++++gWk
  Pp3c17_13550V3.2.p 709 SSFPPDHVDRQLIDHEIVGREILNVVACEGLERVERTETYRQWQARTTRAGFQQIPSSGETMAKIKMAMRVYHRD-YGVGHDGHWFLIGWK 798
                         *************************************************************************66.*************** PP

                GRAS 364 drpLvsvSaW 373
                         ++   +++ W
  Pp3c17_13550V3.2.p 799 NHITHAMTIW 808
                         ***9999999 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.223413790IPR005202Transcription factor GRAS
PfamPF035141.3E-112440808IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0030154Biological Processcell differentiation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MIIAMAGSKH ERTEGSGGAG EGPSLAAQLQ QVWLQTQMPK AQKRSFTPDS STQNQIPRLS  60
TSNLGADTSA LSKPSALSAL KSLSNLFPEL ANVQEEKKAI ISSVFKEGEH PVALNPAMLQ  120
KKNECLEMML TDNFGNEAQS ERSQVSHSRT SSQTMRSNSY GIQPSSDSLD FSSMCPLTSF  180
NSFSGSTQRS AVDTPEEDFF CPFGRSEPSD SPSVDNTEAT AEVEVAVELE KTPLFLYLTD  240
MLMDEKVEEK KCMFVEMSAY QAMAKELGDL ISYDPSYSSM PGAENTNSEF HFEDNSGLFE  300
KEYLEFQGEE DVVEDVGHVD SWINEILSGP LPPELRDSPD SETKHGHKHA ESPEESCSNA  360
DSEFCSCNTL KDEDFEVAQH HWAYVQANGS YLDSSSSLLD SVNSAHSLQN KNGRMLPVGF  420
TNPISSSNGN EVHVTPVDLT NLLIRCAHAV EQGNFGYANE LINELREHSS AYGNGRQRMA  480
HYFVEALVAK MSGTGGQLYS ALSNNRPSEA QMLKALMLFC EHCPFIQVPH IFANHSIVEA  540
FKGASRVHII DYGILYGVQW PCLLYQLSTR PEGPPHLRIT GIDRPQPGFR PSARIQDTGR  600
RLAKLAKKMG VPFKFHAIAE KWEAITPAHL LLREDEVLAV NCMFRFRHLL DESVTAASPR  660
NLVLSRIKSL NPKVFVQGVF NAGYNAPFFM SRFREALSHF STIFDAMESS FPPDHVDRQL  720
IDHEIVGREI LNVVACEGLE RVERTETYRQ WQARTTRAGF QQIPSSGETM AKIKMAMRVY  780
HRDYGVGHDG HWFLIGWKNH ITHAMTIWEP IRDGSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A1e-5244581025380Protein SCARECROW
5b3h_A9e-5344581024379Protein SCARECROW
5b3h_D9e-5344581024379Protein SCARECROW
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.22410.0gametophore| protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024400152.10.0scarecrow-like protein 11
RefseqXP_024400154.10.0scarecrow-like protein 11
TrEMBLA0A2K1J3R70.0A0A2K1J3R7_PHYPA; Uncharacterized protein
STRINGPP1S98_14V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-130SCARECROW-like 14