PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c16_6460V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 370aa    MW: 40519.5 Da    PI: 5.4171
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c16_6460V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof118.33e-373086460
             zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                       k l+cprC+s+ntkfCyynny+++qPr+fC++C+ryWt GG+lrnvPvGgg+rk+ +
  Pp3c16_6460V3.1.p 30 KVLPCPRCQSMNTKFCYYNNYNVNQPRHFCRNCQRYWTVGGTLRNVPVGGGSRKKLR 86
                       7789**************************************************865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074786.0E-262683IPR003851Zinc finger, Dof-type
PfamPF027018.8E-323184IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.633286IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103470IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MADSGLGSGE GDSPVQSKGN GGAIREKPVK VLPCPRCQSM NTKFCYYNNY NVNQPRHFCR  60
NCQRYWTVGG TLRNVPVGGG SRKKLRMARS RTDPYLRAGE APQTGPLSSM SGADGLLGAS  120
TCVQQLPMLP STPGLVCFGT QLSGFAPAGS QLPFVQTALE QSQSMYTRVQ QKPLAGLQEV  180
PDLQSVYDVP QVPQFPQVGS ELLNMSSLMM DDGFFKMPGD LHLPSDSEAL ASVITKADLW  240
SNPMQQLSSL NGSTWEDSRP SKSSFTSQLQ NLSGYEDRRN PMNQVNVNMF LPNTKPQFWG  300
SAIMNQKSLM DDRLVPHTSW DENQSTQTSL SPTESSSLEE ERSLPNYFSS QYEDVPQSWA  360
GLLASDILF*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.32820.0gametophore| protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024399170.10.0uncharacterized protein LOC112293691
TrEMBLA0A2K1J7E40.0A0A2K1J7E4_PHYPA; Uncharacterized protein
STRINGPP1S341_43V6.30.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-33cycling DOF factor 2