PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c16_6100V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family ARF
Protein Properties Length: 783aa    MW: 86088.8 Da    PI: 6.1277
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c16_6100V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B382.73.4e-26134235199
                        EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                        f+k+lt sd++++g +++p++ ae++        +++++ +l+ +d++g +W++++iyr++++r++lt+GW+ Fv+a++L +gD+v+F   +
  Pp3c16_6100V3.3.p 134 FCKTLTASDTSTHGGFSVPRRSAEDClpsldyTANPPCQ-ELVAKDLHGHEWKFRHIYRGHPRRHLLTTGWSAFVSAKKLVAGDTVIFL--R 222
                        99****************************996677775.9************************************************..4 PP

                        SSEE..EEEEE-S CS
                 B3  87 rsefelvvkvfrk 99 
                         ++++l+v+v+r+
  Pp3c16_6100V3.3.p 223 GENGQLRVGVRRA 235
                        489999*****97 PP

2Auxin_resp112.15.4e-37260342183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        a+ha ++++ F+v+YnPr+s+seFv++++k++ka+++k++vG+Rf+m+fe+e+sserr++Gt++ vsd+dpvrWpnS Wrs+k
  Pp3c16_6100V3.3.p 260 ASHASREGMRFSVIYNPRTSPSEFVIPYNKFLKAMDNKLAVGSRFRMKFESEESSERRFAGTITEVSDADPVRWPNSLWRSMK 342
                        6799999*************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.7E-40122241IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.9E-42127246IPR015300DNA-binding pseudobarrel domain
CDDcd100179.00E-26132234No hitNo description
SMARTSM010197.0E-24134236IPR003340B3 DNA binding domain
PfamPF023621.9E-23134235IPR003340B3 DNA binding domain
PROSITE profilePS5086313.634134236IPR003340B3 DNA binding domain
PfamPF065078.9E-33260342IPR010525Auxin response factor
PfamPF023091.0E-9672764IPR033389AUX/IAA domain
PROSITE profilePS5174525.81678761IPR000270PB1 domain
SuperFamilySSF542771.57E-9680756No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 783 aa     Download sequence    Send to blast
MYGYGGGMMR GPIKNQGLSK MDELDYELWH ACAGPLTSVP PVDSLVMYWP QGHIEQVIAC  60
TPDSAGAADV REASSHFKLP SHLLCKIGQL ELQADPHTDE VFAQMDLLPQ DEGSLTKEMK  120
DATHVAKQNN VKMFCKTLTA SDTSTHGGFS VPRRSAEDCL PSLDYTANPP CQELVAKDLH  180
GHEWKFRHIY RGHPRRHLLT TGWSAFVSAK KLVAGDTVIF LRGENGQLRV GVRRASKQQP  240
QARSTNFSST NLHLGVLAAA SHASREGMRF SVIYNPRTSP SEFVIPYNKF LKAMDNKLAV  300
GSRFRMKFES EESSERRFAG TITEVSDADP VRWPNSLWRS MKVEWDEVIS ASERHERVSP  360
WEIEPFVQIS TLPPPQLGPR QKRRLPTLVK ESPLGTSQSV LDSYQSNKLA KILQGFDPRN  420
ESSMEDDEDG DVACSGNTSW NVKPEPPPKG LPQAEIVQQS WFPRPDISSY GIPGDPYQPL  480
ISPRVSSVTS FAPPLAAESM DLQLSVKSAR SEQAPSKDYS SAPWSDFSGI CPSNRTGASF  540
PVRESPCPSI NPSWLYSAST SRAVFERSIL TNSLHSESAP EMLPPQAVPA FEVRDKAQLE  600
KVDTTPGLVQ PCKLFGFNLA DKIVPTLAPL PPSQGDVSEG LVDSIRTDST SPTSGGPFGS  660
KVAAESSQVS QAHAAPMRSG IKVYQQGKVG RTIDLRKCES YDGLRRVLAN LFNLQGQLDD  720
VTKGWQLVYT DHENDVLLVG DDPWEEFCGC VRSLKILSPQ DAAGQTVGRI PASSCEEDDE  780
WH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1212236617355Auxin response factor 1
4ldw_A1e-1212236617355Auxin response factor 1
4ldw_B1e-1212236617355Auxin response factor 1
4ldx_A1e-1212236617355Auxin response factor 1
4ldx_B1e-1212236617355Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.133501e-171protonema
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024398384.10.0auxin response factor 7-like isoform X1
RefseqXP_024398385.10.0auxin response factor 7-like isoform X2
RefseqXP_024398386.10.0auxin response factor 7-like isoform X2
RefseqXP_024398387.10.0auxin response factor 7-like isoform X2
RefseqXP_024398388.10.0auxin response factor 7-like isoform X2
TrEMBLA0A2K1J7D00.0A0A2K1J7D0_PHYPA; Auxin response factor
STRINGPP1S341_4V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.41e-144auxin response factor 2