PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c16_21410V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 342aa    MW: 38138.6 Da    PI: 4.8359
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c16_21410V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.34.7e-1785138356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++t +q++ Le+ F  ++++  e++  LAk+lgL  rqV vWFqNrRa+++
  Pp3c16_21410V3.1.p  85 KKRRLTFDQVRFLEKNFDIENKLEPERKLLLAKELGLRPRQVAVWFQNRRARWR 138
                         5668999**********************************************9 PP

2HD-ZIP_I/II117.95.6e-3885176293
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                         kkrrl+ +qv++LE++F+ e+kLeperK  la+eLgl+prqvavWFqnrRAR++tkqlE+dye+L + y++lk+e e++ +e+++L+ e++
  Pp3c16_21410V3.1.p  85 KKRRLTFDQVRFLEKNFDIENKLEPERKLLLAKELGLRPRQVAVWFQNRRARWRTKQLERDYESLTSGYKQLKSEFEAMLQEKQDLQGEVE 175
                         9**************************************************************************************9987 PP

         HD-ZIP_I/II  93 e 93 
                         +
  Pp3c16_21410V3.1.p 176 R 176
                         5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.76E-1967142IPR009057Homeodomain-like
PROSITE profilePS5007116.48780140IPR001356Homeobox domain
SMARTSM003892.9E-1483144IPR001356Homeobox domain
CDDcd000861.28E-1585141No hitNo description
PfamPF000461.5E-1485138IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.5E-1891139IPR009057Homeodomain-like
PROSITE patternPS000270115138IPR017970Homeobox, conserved site
PfamPF021833.7E-15140182IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MTNTGRGCVL GSNVMFVRND TASDSGIAMV ASCSPAAFQV KHGAVGLEDT SVSCGKNRSH  60
YPTFDASGED LGEEDHGDDC SQPSKKRRLT FDQVRFLEKN FDIENKLEPE RKLLLAKELG  120
LRPRQVAVWF QNRRARWRTK QLERDYESLT SGYKQLKSEF EAMLQEKQDL QGEVERLTEK  180
LQTVQPGPAD PSLEKSKKHI SMSHPSPQWA CEGSVKSERI PEIEANNDGL SPCKEEGSKE  240
TFSDSFSSEL FNSDSPCTMN SGSLLPVPDD TNMCSLVSTE LVGSSIVHMT DGLYEQMLSP  300
KACQRISVKS EHDSCQNNSC NYILAQLDLI EEKGLPWWDW P*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024398254.10.0LOW QUALITY PROTEIN: homeobox-leucine zipper protein ATHB-5-like
TrEMBLA0A2K1J9I90.0A0A2K1J9I9_PHYPA; Uncharacterized protein
STRINGPP1S4_70V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.19e-40homeobox 1