PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c16_19830V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 420aa    MW: 46986.6 Da    PI: 6.824
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c16_19830V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.15.8e-56211481128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelvv+yL++k+++  +e+ ++i evd++k+ePwdLp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd++
  Pp3c16_19830V3.4.p  21 LPPGFRFHPTDEELVVYYLARKIREPGFEV-KTICEVDLNKCEPWDLPEKAKLGEKEWYFFSLRDRKYPTGMRTNRATEKGYWKATGKDRD 110
                         79****************************.88***************99999************************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         v+++ +++lvg+kktLvfy+grap+g+kt+W+mheyrl
  Pp3c16_19830V3.4.p 111 VMNSgTHALVGMKKTLVFYRGRAPRGVKTHWIMHEYRL 148
                         ***966677***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.58E-6318177IPR003441NAC domain
PROSITE profilePS5100559.87321177IPR003441NAC domain
PfamPF023652.7E-2822148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MTSMCNGTKT IGKQQECTMD LPPGFRFHPT DEELVVYYLA RKIREPGFEV KTICEVDLNK  60
CEPWDLPEKA KLGEKEWYFF SLRDRKYPTG MRTNRATEKG YWKATGKDRD VMNSGTHALV  120
GMKKTLVFYR GRAPRGVKTH WIMHEYRLTS DFPGHFNGQQ PQGSMHDEWV VCRVFQKIAG  180
NKKPGFMCGD MPYQLTDSYS VLHRESSPNP TVTNSGECDA CTGTDSCYNC QDNFAGGVPL  240
AQGDVTSVPA PEWVHVSDSK APNSAAADIS NSMKESQYNQ NAISLNMLNY PTVPQTMVKH  300
SLTSMKSWDH RHNNNGMRAK PEPFYATNEG EDEAQSIGRL NVNHATWPSD NVPFGQEFPY  360
DSPLTPLSTV TGDSGQSFCL ANGRLGNDHQ FRAFNRLLAY SGFPAMSGSI DGLQSEWAY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-551918318174NAC domain-containing protein 19
3swm_B2e-551918318174NAC domain-containing protein 19
3swm_C2e-551918318174NAC domain-containing protein 19
3swm_D2e-551918318174NAC domain-containing protein 19
3swp_A2e-551918318174NAC domain-containing protein 19
3swp_B2e-551918318174NAC domain-containing protein 19
3swp_C2e-551918318174NAC domain-containing protein 19
3swp_D2e-551918318174NAC domain-containing protein 19
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00663PBM25215497Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S327_64V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G07680.11e-77NAC domain containing protein 80