PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c16_13150V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 416aa    MW: 46591.2 Da    PI: 7.1788
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c16_13150V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.74e-52131401128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelv +yL++k++++ +++  vi+ev++yk++PwdLp+k+  +++ewyfFs+r +ky++g r+nra++sgyWkatg+dk 
  Pp3c16_13150V3.2.p  13 LPPGFRFHPTDEELVLHYLRRKADSDAFKI-PVIAEVNLYKFDPWDLPNKALFGDREWYFFSPRYRKYPNGARPNRAAASGYWKATGTDKL 102
                         79****************************.89***************888889************************************* PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++ + ++ +vg+kk Lvfy+g+apkgekt+W+mheyrl
  Pp3c16_13150V3.2.p 103 IHMStGHGKVGVKKALVFYRGKAPKGEKTNWIMHEYRL 140
                         *98867788***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.98E-638169IPR003441NAC domain
PROSITE profilePS5100560.32313169IPR003441NAC domain
PfamPF023658.8E-2814140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MELGRGSIDQ LQLPPGFRFH PTDEELVLHY LRRKADSDAF KIPVIAEVNL YKFDPWDLPN  60
KALFGDREWY FFSPRYRKYP NGARPNRAAA SGYWKATGTD KLIHMSTGHG KVGVKKALVF  120
YRGKAPKGEK TNWIMHEYRL AEGVSTSNNH HRRGSLRLDD WVLCRIYEKT THAQRAGKEQ  180
ENSCVEEVLA SLPNSIDDSR LALPHLNTSN GSLEFAVQQE ALVDSLLVEN SSENGCLSAS  240
FDSLQRETMS NNPGVSVQDL QNLTNEWKLQ QSMATDHDNL ERSRLMEQLA SVPSVHRLAV  300
STQPMADGGM AQFQHPPRSY TFGQRNCQEK PMPAGRSASD DEVQSMFRAT AMGFTNTGSS  360
NAHGLESMFS GMGYEAQPNL SCGRPGGLEN WAYPIMPSQP RMDFNFNYAP KSTFN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A5e-78817515174NAC domain-containing protein 19
3swm_B5e-78817515174NAC domain-containing protein 19
3swm_C5e-78817515174NAC domain-containing protein 19
3swm_D5e-78817515174NAC domain-containing protein 19
3swp_A5e-78817515174NAC domain-containing protein 19
3swp_B5e-78817515174NAC domain-containing protein 19
3swp_C5e-78817515174NAC domain-containing protein 19
3swp_D5e-78817515174NAC domain-containing protein 19
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001769642.11e-126predicted protein, partial
SwissprotA0SPJ92e-79NAM2_HORVD; NAC transcription factor NAM-2
SwissprotQ93VY32e-79NAC72_ARATH; NAC domain-containing protein 72
TrEMBLA9STG21e-126A9STG2_PHYPA; Predicted protein (Fragment)
STRINGPP1S15_200V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.21e-80NAC domain containing protein 47