PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c15_4480V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family G2-like
Protein Properties Length: 525aa    MW: 57094.9 Da    PI: 6.7054
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c15_4480V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.62.1e-31293348156
            G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                        k r++W+peLH+rFv+a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Pp3c15_4480V3.1.p 293 KSRRCWSPELHRRFVSALHQLGGSQIATPKQIRELMKVDGLTNDEVKSHLQKYRLH 348
                        68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.06289350IPR017930Myb domain
SuperFamilySSF466892.19E-17291351IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-28291351IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-25293348IPR006447Myb domain, plants
PfamPF002491.4E-7295346IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MGSPVDLTLG CSTQAPSSNG YYNHQNEPTH SENYLESLRE VEERVRSLEE ERRKVEGFKR  60
ELPLCIQLLE DAIKTWKVKL VNGKHLPLQL RSGSMDSGRN QHVMPSSPGS RPTLEDFMPF  120
KRRWEQRDQP SESSDVEEEV RGSKRPAWLT EAPLWRQSSG CSEREGKEVQ EHSEFGISER  180
EQSSITSSQM LLSAKQRPAG AFLPFIRDQP GASSFLSRPT PRTVASAADL SLSLGERTTT  240
PSSRNLRPSD SEVGSIDAGL QTPEVQIPKD IGVMSNGTSG AGSSSGGGNP TRKSRRCWSP  300
ELHRRFVSAL HQLGGSQIAT PKQIRELMKV DGLTNDEVKS HLQKYRLHTR RPSSSPQSGG  360
MGQSPQLVVL GGIWVPPQYA ASGSQPSPGF YNPSAAHSPQ PNQFCPTSLP QGYSCISNST  420
QGAQLEMHRE PIFEPPRQAG TSQSQSSPQG PLQVTSQLSG ATQGPSSAAY HDESAGEEDA  480
KSESASWKCD NPKGEELKKS NSNQGSGDGQ SRAHVSEEDV NQAD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A6e-14293346154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B6e-14293346154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C6e-14293346154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D6e-14293346154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.25400.0protonema
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024395921.10.0myb family transcription factor EFM-like
RefseqXP_024395922.10.0myb family transcription factor EFM-like
RefseqXP_024395923.10.0myb family transcription factor EFM-like
TrEMBLA0A2K1JBV90.0A0A2K1JBV9_PHYPA; Uncharacterized protein
STRINGPP1S83_100V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP43031624
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-53G2-like family protein