PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c15_3180V3.1.p
Common NamePHYPADRAFT_166789
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 404aa    MW: 44421 Da    PI: 6.5064
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c15_3180V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof116.88.8e-3765122360
             zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                         k l+cprC+s+ntkfCyynnys++qPr+fC++C+ryWt GG+lrnvPvGgg+r +++
  Pp3c15_3180V3.1.p  65 PKDLPCPRCQSMNTKFCYYNNYSVNQPRHFCRNCQRYWTVGGTLRNVPVGGGSRVKHS 122
                        67899*************************************************8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-2266118IPR003851Zinc finger, Dof-type
PfamPF027012.3E-3167121IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.87668122IPR003851Zinc finger, Dof-type
PROSITE patternPS01361070106IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 404 aa     Download sequence    Send to blast
MHLPLQHQAR LAGSFDDENE ELHAQLQANS VSHSHSHHSQ EDDVSQSQGS KGSGGDTTPN  60
GTTKPKDLPC PRCQSMNTKF CYYNNYSVNQ PRHFCRNCQR YWTVGGTLRN VPVGGGSRVK  120
HSRPRNRTDP YYRPGANPSN ESDAETDQSG ISLHPYLAHA MAGMVPPDMA GLLPDAGFPD  180
YPDPAEFPFH PSQISNLLQL ALLQNPSMYG MPFPVGNPER DEAETLQAMY EAQAAPNSGN  240
LLAVAAAMML MPDLDPSTMS LLHKATLWAE AQRAQAMSRR QTTQHAAQAA SAWAEERECK  300
PSVSAQMHRE IVAREELRHR QQVAGMHRRP GFWETALWYS RPNKRPAWDE ASPSPKPAQQ  360
GSTRTLDEEA GNTANASSFS HGYDDTSSWG SVGLNAGQDL FFS*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.38430.0gametophore| protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024396700.10.0uncharacterized protein LOC112292442
TrEMBLA9SVJ30.0A9SVJ3_PHYPA; Predicted protein
STRINGPP1S124_139V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.16e-29cycling DOF factor 3
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]