PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c15_22780V3.4.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 172aa    MW: 19054.6 Da    PI: 7.0826
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c15_22780V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260142.11.8e-4481071100
              DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91 
                         +CaaCk+lrr+C++dCv+apyfp ++p+kfanvhk+FGa+nv k+l++lp e r da+ss+vyeA+ar+rdPvyG+vg i++lqqq+++l+
  Pp3c15_22780V3.4.p   8 PCAACKLLRRRCTRDCVFAPYFPPDEPQKFANVHKVFGAANVNKMLQELPVEARGDAVSSMVYEADARVRDPVYGCVGAISSLQQQVAHLQ 98 
                         7****************************************************************************************** PP

              DUF260  92 aelallkee 100
                         ++la++++e
  Pp3c15_22780V3.4.p  99 TQLAVANAE 107
                         ****99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.8697108IPR004883Lateral organ boundaries, LOB
PfamPF031952.5E-448105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MAGSGMSPCA ACKLLRRRCT RDCVFAPYFP PDEPQKFANV HKVFGAANVN KMLQELPVEA  60
RGDAVSSMVY EADARVRDPV YGCVGAISSL QQQVAHLQTQ LAVANAEIVC MRMHNTESSR  120
DSDNSRHIQG SYQQGLSPPL QPQSPELQNY YKPTAHYHRT DNMELAELLW T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-4831097112LOB family transfactor Ramosa2.1
5ly0_B1e-4831097112LOB family transfactor Ramosa2.1
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed predominantly in roots, and at low levels in shoots, floral stems and open flowers. {ECO:0000269|PubMed:12068116}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024397549.11e-127LOB domain-containing protein 4-like
RefseqXP_024397551.11e-127LOB domain-containing protein 4-like
RefseqXP_024397552.11e-127LOB domain-containing protein 4-like
RefseqXP_024397553.11e-127LOB domain-containing protein 4-like
RefseqXP_024397554.11e-127LOB domain-containing protein 4-like
SwissprotQ8LBW37e-61LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A2K1JE801e-126A0A2K1JE80_PHYPA; Uncharacterized protein
STRINGPP1S66_56V6.11e-127(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.12e-63LBD family protein
Publications ? help Back to Top
  1. Penfield S, et al.
    Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1.
    Plant Cell, 2004. 16(10): p. 2705-18
    [PMID:15367715]