PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c15_21200V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 223aa    MW: 25529.7 Da    PI: 8.4881
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c15_21200V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox629e-2076128456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + +ftk ql+ Le+ Fe+ + p+a++++ LA++lg++ rqV vWFqNrRa+ k
  Pp3c15_21200V3.3.p  76 KLRFTKAQLRHLEDTFERLQRPNAHQKATLAMELGVQPRQVEVWFQNRRARGK 128
                         568************************************************88 PP

2HD-ZIP_I/II92.64.3e-3075154281
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                         +k+r++k q++ LE++Fe+ ++ + ++K++la eLg+qprqv+vWFqnrRAR k+k++E+d+e+L+++++ l  en++L+
  Pp3c15_21200V3.3.p  75 QKLRFTKAQLRHLEDTFERLQRPNAHQKATLAMELGVQPRQVEVWFQNRRARGKAKRTETDCEVLRQRCQDLIVENHQLN 154
                         79***************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.8670130IPR001356Homeobox domain
SMARTSM003892.7E-1472134IPR001356Homeobox domain
SuperFamilySSF466891.33E-1774128IPR009057Homeodomain-like
PfamPF000463.9E-1776128IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-1877134IPR009057Homeodomain-like
CDDcd000868.12E-1578126No hitNo description
PRINTSPR000311.8E-5101110IPR000047Helix-turn-helix motif
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PRINTSPR000311.8E-5110126IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 223 aa     Download sequence    Send to blast
MGSSYHYYTK PLLPGRENIV AFSSGNMGSC DCDDSSQISR QPLHLDQRFI FRAVFPGGSS  60
DASTEYDDDD EGASQKLRFT KAQLRHLEDT FERLQRPNAH QKATLAMELG VQPRQVEVWF  120
QNRRARGKAK RTETDCEVLR QRCQDLIVEN HQLNYLIQRE WVTTVTTSWR TANPLCNCSS  180
LCATPVRKSE ADRLRQGMQL PPVRRMDPKQ PVQTHTYTHT SL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024396326.11e-116homeobox-leucine zipper protein HOX17-like
RefseqXP_024396327.11e-116homeobox-leucine zipper protein HOX17-like
TrEMBLA0A2K1JE051e-115A0A2K1JE05_PHYPA; Uncharacterized protein
STRINGPP1S454_12V6.11e-116(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.16e-24homeobox from Arabidopsis thaliana