PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c15_21200V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 193aa    MW: 21993.7 Da    PI: 8.138
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c15_21200V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.46.9e-2076128456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         + +ftk ql+ Le+ Fe+ + p+a++++ LA++lg++ rqV vWFqNrRa+ k
  Pp3c15_21200V3.1.p  76 KLRFTKAQLRHLEDTFERLQRPNAHQKATLAMELGVQPRQVEVWFQNRRARGK 128
                         568************************************************88 PP

2HD-ZIP_I/II94.79.9e-3175155282
         HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLek 82 
                         +k+r++k q++ LE++Fe+ ++ + ++K++la eLg+qprqv+vWFqnrRAR k+k++E+d+e+L+++++ l  en++L+ 
  Pp3c15_21200V3.1.p  75 QKLRFTKAQLRHLEDTFERLQRPNAHQKATLAMELGVQPRQVEVWFQNRRARGKAKRTETDCEVLRQRCQDLIVENHQLNY 155
                         79***************************************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.9E-1956124IPR009057Homeodomain-like
PROSITE profilePS5007116.8670130IPR001356Homeobox domain
SMARTSM003892.7E-1472134IPR001356Homeobox domain
SuperFamilySSF466899.41E-1874128IPR009057Homeodomain-like
PfamPF000463.0E-1776128IPR001356Homeobox domain
CDDcd000862.68E-1578126No hitNo description
PRINTSPR000311.4E-5101110IPR000047Helix-turn-helix motif
PROSITE patternPS000270105128IPR017970Homeobox, conserved site
PRINTSPR000311.4E-5110126IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MGSSYHYYTK PLLPGRENIV AFSSGNMGSC DCDDSSQISR QPLHLDQRFI FRAVFPGGSS  60
DASTEYDDDD EGASQKLRFT KAQLRHLEDT FERLQRPNAH QKATLAMELG VQPRQVEVWF  120
QNRRARGKAK RTETDCEVLR QRCQDLIVEN HQLNYLIQSE RMGYDSHHLM ANGKSPLQLQ  180
LALCNSCKKV RS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024396326.11e-144homeobox-leucine zipper protein HOX17-like
RefseqXP_024396327.11e-144homeobox-leucine zipper protein HOX17-like
TrEMBLA0A2K1JE051e-142A0A2K1JE05_PHYPA; Uncharacterized protein
STRINGPP1S454_12V6.11e-143(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-26homeobox from Arabidopsis thaliana