PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c15_17600V3.6.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 770aa    MW: 85702.4 Da    PI: 5.2248
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c15_17600V3.6.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS334.42e-1023967652374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         +elL++cA avs+g+ ++a+ lL+ l++++sp+g+++qR+a+yf+eAL a+l+++++ely+ +  +  s    + +++a +l+ e +P+l 
  Pp3c15_17600V3.6.p 396 TELLYRCALAVSQGNVREATDLLSDLRQISSPNGNATQRMAHYFMEALVAKLSGTGEELYRVIINNGPS---AAIVFKAIRLYLENCPYLI 483
                         789*********************************************************999777666...67888999*********** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         f+h+ + + I++ +eg+ rvH i ++i++G+  p+L+q L++Rpeg+p+lRiTg++sp++g     +++etg+rLa fA++ gvpfe+ + 
  Pp3c15_17600V3.6.p 484 FAHFFTVKSIVDVFEGAARVHLICYGIQYGVELPSLIQYLSQRPEGAPHLRITGIDSPHPGnnPCLKINETGRRLAMFAKKWGVPFEYVA- 573
                         **********************************************************99977788999*********************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +a ++e+++ ++++++++E+laV+++ +lh+l+desv  +s+r+ v + ++s++Pk++v+v     hn++ F++rf e++++ysa+++ l+
  Pp3c15_17600V3.6.p 574 LAGSWESFTARDMNLREDEVLAVSSQDSLHTLPDESVMATSPRELVFRRIRSMNPKLFVMVGMHGGHNAPFFMTRFRESVKHYSAIYEGLD 664
                         599**************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                          ++pr++ +r+ vEre++g +i n+vaceg++r+er e +++W++r+++aGF+++p+ +++ +++k+++  +++d y v  ++g++++g +
  Pp3c15_17600V3.6.p 665 ISMPRDDPDRVIVEREIFGSQILNIVACEGQARVERAEPYRQWQNRFQRAGFTQLPILDTVFNKMKAMMGAFHKD-YGVGRDDGWFLMGIR 754
                         *************************************************************************77.*************** PP

                GRAS 364 drpLvsvSaWr 374
                         ++ + ++SaW+
  Pp3c15_17600V3.6.p 755 NQIVKFCSAWE 765
                         **********5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098558.338369746IPR005202Transcription factor GRAS
PfamPF035147.1E-100396765IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 770 aa     Download sequence    Send to blast
MVGTRRVEGS SQATHTEISP LESLLQRAWL QTHKSKGSRR LSSAPLPDVA DEKRGFSRIA  60
SLPAFSGTRF PRSDDQEESD KVYFHKSRLD ASTVLVSRFS LPELTSYSSK TYVPLSVSLV  120
QWTHSEPVAG HGLSQALKPL TKSSTESSET LSGQSRHSLG ATESEVSSTS SVDFERQAQP  180
MASFLGGILT DENLEEENLH ETRAYQAIAK EIADLIGLNS SVETETSDIV DYESCWADAE  240
PYRTEAEMHI LEQSGAYQAM VKEIAELISP HPAVIDTDET DLSDGKASDS ADFRPTEELA  300
ARGMMEAYSH ILTRHLEDVA INSDSDAAST IKYRTTETDT IVTYFNEDWK LYLQNLNQNF  360
TPTSNFDFNL LLCGAVEGSK VSADNAVPSS SSGSLTELLY RCALAVSQGN VREATDLLSD  420
LRQISSPNGN ATQRMAHYFM EALVAKLSGT GEELYRVIIN NGPSAAIVFK AIRLYLENCP  480
YLIFAHFFTV KSIVDVFEGA ARVHLICYGI QYGVELPSLI QYLSQRPEGA PHLRITGIDS  540
PHPGNNPCLK INETGRRLAM FAKKWGVPFE YVALAGSWES FTARDMNLRE DEVLAVSSQD  600
SLHTLPDESV MATSPRELVF RRIRSMNPKL FVMVGMHGGH NAPFFMTRFR ESVKHYSAIY  660
EGLDISMPRD DPDRVIVERE IFGSQILNIV ACEGQARVER AEPYRQWQNR FQRAGFTQLP  720
ILDTVFNKMK AMMGAFHKDY GVGRDDGWFL MGIRNQIVKF CSAWEPKCP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_A3e-4540176725381Protein SCARECROW
5b3h_A3e-4540176724380Protein SCARECROW
5b3h_D3e-4540176724380Protein SCARECROW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024397051.10.0scarecrow-like transcription factor PAT1
TrEMBLA0A2K1JDI60.0A0A2K1JDI6_PHYPA; Uncharacterized protein
STRINGPP1S359_32V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.11e-100SCARECROW-like 14