PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_24330V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 244aa    MW: 26268.4 Da    PI: 8.0154
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_24330V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26061.22.8e-19571173292
              DUF260  32 nvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                          + ++FG++nv+k+l++lp+ +red ++sl+yeA+a ++dPvyG+vg i+ lqqq +++++
  Pp3c14_24330V3.2.p  57 GTLQVFGVANVTKMLHELPPPHREDCVNSLAYEADAGVQDPVYGCVGAISVLQQQGKTAEV 117
                         5669***************************************************988775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089110.12725125IPR004883Lateral organ boundaries, LOB
PfamPF031951.0E-1758117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MRQKLNSNDF MVSLALSLLL CGFNVDRSLV PSARARISII IQPLHQFGTS DSKKRGGTLQ  60
VFGVANVTKM LHELPPPHRE DCVNSLAYEA DAGVQDPVYG CVGAISVLQQ QGKTAEVVIT  120
THNYLAFCGA LADTTGDSNL RDQDFVRPSP SPPAPPTLTP VLLFANLLLQ STSQLSYLGL  180
LKLLRTINLP TLIAPLLQLI HQMKNHPPSN NHSQPLLLGT PQGLLLQNSS GFLAVLLEHL  240
SLS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-20471113296LOB family transfactor Ramosa2.1
5ly0_B3e-20471113296LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S69_130V6.11e-128(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.16e-21LOB domain-containing protein 25