PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_24190V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 349aa    MW: 37602.6 Da    PI: 6.7784
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_24190V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.21.7e-3853111260
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                         ++k l+cprC+s+ntkfCyynnys++qPr+fC++C+ryWt+GG+lrnvPvGgg+rk+ +
  Pp3c14_24190V3.1.p  53 PDKVLPCPRCESMNTKFCYYNNYSVTQPRHFCRQCQRYWTAGGTLRNVPVGGGSRKKSR 111
                         78999***************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2551108IPR003851Zinc finger, Dof-type
PfamPF027013.8E-3354111IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.67757111IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105995IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MQLPAQQQND SAALVATVPH GSSNALNGGG DAPASPSSPG SPSKNAIATR EKPDKVLPCP  60
RCESMNTKFC YYNNYSVTQP RHFCRQCQRY WTAGGTLRNV PVGGGSRKKS RHPRGIAEPY  120
LQRSGAFGVA SSGEQSAMQN VGFQQMLTQD MVGLNFAQLP GFGPQNPHHY LPFSMDHTQV  180
AYVPMTNKPP CQEDLSNLHA MYGNAPMSAP TGGYYLAPEL GGENSGNAVK PEFWVNNMVA  240
PQVPVPGSNP NQTVNRNGCL DSSMLLNLGL NNRPSAQVSG NGKPVWDQQD VKRPLSQQKN  300
GSPPHGSSTI EEEGSTPTNE YSNSGYEEGD TVSSMWNDMQ HDMDNIFQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.43172e-73gametophore| protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024394292.10.0dof zinc finger protein DOF4.3-like
TrEMBLA0A2K1JJ500.0A0A2K1JJ50_PHYPA; Uncharacterized protein
STRINGPP1S69_113V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.15e-32Dof family protein