PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_21680V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 358aa    MW: 39759.6 Da    PI: 5.5253
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_21680V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox53.25.1e-17103155456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++++ eq++ Le+ Fe++ ++  +++ +LAk+lgL+ rq+ vWFqNrRa++k
  Pp3c14_21680V3.1.p 103 KRRLSFEQVRSLERNFEMEIKLEPDRKMKLAKELGLQPRQIAVWFQNRRARWK 155
                         4578889*********************************************9 PP

2HD-ZIP_I/II116.91.2e-37101192192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls eqv++LE++Fe+e kLep+rK++la+eLglqprq+avWFqnrRAR+ktkqlE+d+e L + y +lk++ e++ +e++ L++el
  Pp3c14_21680V3.1.p 101 EKKRRLSFEQVRSLERNFEMEIKLEPDRKMKLAKELGLQPRQIAVWFQNRRARWKTKQLERDFELLNSGYSKLKRDFEKVLEEKDVLKAEL 191
                         69**************************************************************************************998 PP

         HD-ZIP_I/II  92 k 92 
                          
  Pp3c14_21680V3.1.p 192 V 192
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.9E-1879158IPR009057Homeodomain-like
SuperFamilySSF466891.24E-1890159IPR009057Homeodomain-like
PROSITE profilePS5007116.98997157IPR001356Homeobox domain
SMARTSM003896.9E-14100161IPR001356Homeobox domain
CDDcd000863.48E-15102158No hitNo description
PfamPF000463.4E-14102155IPR001356Homeobox domain
PRINTSPR000311.4E-5128137IPR000047Helix-turn-helix motif
PROSITE patternPS000270132155IPR017970Homeobox, conserved site
PRINTSPR000311.4E-5137153IPR000047Helix-turn-helix motif
PfamPF021835.0E-13157197IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MAALGRAGET MSMTATGLSS FGGQNLMRMM NDMGISNSLV AMLTSCNPHA GFRVSSSGGG  60
LEEEATGRGQ KRPHYPISDK GPGEEPEEGD DCCYDGAHPM EKKRRLSFEQ VRSLERNFEM  120
EIKLEPDRKM KLAKELGLQP RQIAVWFQNR RARWKTKQLE RDFELLNSGY SKLKRDFEKV  180
LEEKDVLKAE LVRLSAKIIP KDSQSVDFSQ SEKDSHCKPT ANDPAKSDKL KESKPATPKD  240
NQSTRSSPTT VVCSATTLEA EITSTSSGSN SSDLLDADSP RTTDSNPREE QLANYCGQLL  300
PENFVGHLTV EEAVNTSQKV YSVKLEDGCH HFQVDATSGY FLPPMAEQSI LPWWDWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1149157RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1570.0gametophore| protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0280790.0AB028079.1 Physcomitrella patens mRNA for homeobox protein Pphb8, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024401525.11e-133homeobox-leucine zipper protein HOX20-like
TrEMBLA0A2K1JIR20.0A0A2K1JIR2_PHYPA; Uncharacterized protein
STRINGPP1S34_327V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G40060.13e-36homeobox protein 16