PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_21620V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 291aa    MW: 33340.3 Da    PI: 5.9394
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_21620V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.83.7e-184092456
                        -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox  4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                        +++++ +q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c14_21620V3.2.p 40 KRRLSFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWK 92
                        4578889*********************************************9 PP

2HD-ZIP_I/II119.71.5e-3838130193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls +qv++LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+k kqlE dy+aL + y++lk++ ++  +++++L++e+
  Pp3c14_21620V3.2.p  38 EKKRRLSFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKIKQLECDYDALTQDYNRLKNDFDAALRDKKKLKNEV 128
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Pp3c14_21620V3.2.p 129 NR 130
                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.3E-191394IPR009057Homeodomain-like
SuperFamilySSF466893.18E-191895IPR009057Homeodomain-like
PROSITE profilePS5007117.4593494IPR001356Homeobox domain
SMARTSM003891.8E-143798IPR001356Homeobox domain
CDDcd000861.11E-153995No hitNo description
PfamPF000461.7E-154092IPR001356Homeobox domain
PRINTSPR000314.7E-66574IPR000047Helix-turn-helix motif
PROSITE patternPS0002706992IPR017970Homeobox, conserved site
PRINTSPR000314.7E-67490IPR000047Helix-turn-helix motif
PfamPF021833.5E-1494133IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MNAGCVLKRP YYTAYENPSS LETDYADDGC DEFSHRVEKK RRLSFDQVRS LERNFEVENK  60
LEPERKMQLA KELGLQPRQV AVWFQNRRAR WKIKQLECDY DALTQDYNRL KNDFDAALRD  120
KKKLKNEVNR LKGIAPEVPK NVDAPKLKHF KGQPVSPAHS EKSDIVSSKT HPTPTIDVLP  180
IADQESTEHR FKRTMSYDSN SSDVMDAESP RTADSSNPST LVDASWAQYH NPQFPPENYV  240
GPISNLHLAD GDMVSPQVKL EEMAGFPTDQ AFLLSQLENQ TILPNWWDWA *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18694RRARWKIKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.90120.0sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024393840.10.0homeobox-leucine zipper protein ATHB-5-like
TrEMBLA0A2K1JIQ60.0A0A2K1JIQ6_PHYPA; Uncharacterized protein
STRINGPP1S34_317V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.16e-39homeobox protein 6