PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_21620V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 370aa    MW: 41837 Da    PI: 5.6643
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_21620V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.35.4e-18119171456
                         -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++++ +q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c14_21620V3.1.p 119 KRRLSFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWK 171
                         4578889*********************************************9 PP

2HD-ZIP_I/II119.12.5e-38117209193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrls +qv++LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+k kqlE dy+aL + y++lk++ ++  +++++L++e+
  Pp3c14_21620V3.1.p 117 EKKRRLSFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKIKQLECDYDALTQDYNRLKNDFDAALRDKKKLKNEV 207
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Pp3c14_21620V3.1.p 208 NR 209
                         75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.1E-1992173IPR009057Homeodomain-like
SuperFamilySSF466895.01E-1997174IPR009057Homeodomain-like
PROSITE profilePS5007117.459113173IPR001356Homeobox domain
SMARTSM003891.8E-14116177IPR001356Homeobox domain
CDDcd000868.42E-16118174No hitNo description
PfamPF000462.5E-15119171IPR001356Homeobox domain
PRINTSPR000317.0E-6144153IPR000047Helix-turn-helix motif
PROSITE patternPS000270148171IPR017970Homeobox, conserved site
PRINTSPR000317.0E-6153169IPR000047Helix-turn-helix motif
PfamPF021834.9E-14173212IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MIAGPNALAR SALVKILSDA ADRSENMAVA SLGPYVGQNL NMLLQHKDQH ADTLIAMLGS  60
RSPQMSLQQV PRSLEDLEDM NAGCVLKRPY YTAYENPSSL ETDYADDGCD EFSHRVEKKR  120
RLSFDQVRSL ERNFEVENKL EPERKMQLAK ELGLQPRQVA VWFQNRRARW KIKQLECDYD  180
ALTQDYNRLK NDFDAALRDK KKLKNEVNRL KGIAPEVPKN VDAPKLKHFK GQPVSPAHSE  240
KSDIVSSKTH PTPTIDVLPI ADQESTEHRF KRTMSYDSNS SDVMDAESPR TADSSNPSTL  300
VDASWAQYHN PQFPPENYVG PISNLHLADG DMVSPQVKLE EMAGFPTDQA FLLSQLENQT  360
ILPNWWDWA*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1165173RRARWKIKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.90120.0sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024393840.10.0homeobox-leucine zipper protein ATHB-5-like
TrEMBLA0A2K1JIQ60.0A0A2K1JIQ6_PHYPA; Uncharacterized protein
STRINGPP1S34_317V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22430.13e-38homeobox protein 6