PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_21500V3.1.p
Common NamePHYPADRAFT_71904
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family B3
Protein Properties Length: 427aa    MW: 47469 Da    PI: 8.8614
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_21500V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B340.25.9e-1335126298
                         EEE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE...EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE. CS
                  B3   2 fkvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliy.rkksgryvltkGWkeFvkangLkegDfvvFkldgrsefe 91 
                         +k++t      ++ l +p +f+ +++  ++ +k +tle +s + W+v++   + ++++  +++GW++Fv +++++ gD + F+l++ s+f 
  Pp3c14_21500V3.1.p  35 IKTMTELT--ITSVLQIPASFV-RCSD-SRIGKVVTLEGPSKENWSVEVGPgTLQRSGLEFRDGWQKFVADHNVQIGDHLFFTLKSYSRF- 120
                         55552222..234599******.5643.358899***************444555555889**********************9988999. PP

                         .EEEEE- CS
                  B3  92 lvvkvfr 98 
                           v+v++
  Pp3c14_21500V3.1.p 121 -QVMVYD 126
                         .666665 PP

2B3604.2e-19286379499
                         E-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EE CS
                  B3   4 vltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvv 94 
                         ++++++v +  ++vl ++f ++++ +  es+++tl ++ g +W vk  ++ + ++  +++GW++F  +++L+e D++vF+ +++++f  +v
  Pp3c14_21500V3.1.p 286 AMSKAYVYRGFWMVLNRPFSKAYMPQ--ESREVTLCNKAGHEWPVKWLFKETNSSSGFSGGWRRFSLDHRLEESDVCVFEIVDETNFVILV 374
                         688999*****************855..7889***************99777777889**********************9999******* PP

                         EEE-S CS
                  B3  95 kvfrk 99 
                         ++fr+
  Pp3c14_21500V3.1.p 375 HIFRA 379
                         **995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.33E-1929128IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-1829129IPR015300DNA-binding pseudobarrel domain
CDDcd100176.24E-1732126No hitNo description
PROSITE profilePS5086312.40732128IPR003340B3 DNA binding domain
PfamPF023623.2E-1034125IPR003340B3 DNA binding domain
SMARTSM010191.6E-634128IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.102.5E-20279379IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.63E-23280380IPR015300DNA-binding pseudobarrel domain
CDDcd100173.84E-25281378No hitNo description
SMARTSM010191.6E-18283380IPR003340B3 DNA binding domain
PROSITE profilePS5086312.957283380IPR003340B3 DNA binding domain
PfamPF023628.0E-17285379IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 427 aa     Download sequence    Send to blast
MKTTACALCL MNCVRLHGDE CEDADGASAP LPSFIKTMTE LTITSVLQIP ASFVRCSDSR  60
IGKVVTLEGP SKENWSVEVG PGTLQRSGLE FRDGWQKFVA DHNVQIGDHL FFTLKSYSRF  120
QVMVYDESGS PKANATAARN SIAAYKDEPK SLSEAQVGTS VIYRSKGPVA RPKHKVRRKI  180
RTKSATKPVV VVGRSSDLEL ENSDPLVKDI TNVTEIVSDS KPQHQSDTIE IPDSPGAAQP  240
LLVPHVVRGG HVISERRAVT QPEKEKVIHA ARLLADTLTN PKIVVAMSKA YVYRGFWMVL  300
NRPFSKAYMP QESREVTLCN KAGHEWPVKW LFKETNSSSG FSGGWRRFSL DHRLEESDVC  360
VFEIVDETNF VILVHIFRAL GQPGEDNSDY RPSSSRDWGV DQRKRKTASN PCVDTNLNYK  420
KPIGFF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1625437822141B3 domain-containing transcription factor VRN1
4i1k_B2e-1625437822141B3 domain-containing transcription factor VRN1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1174180KVRRKIR
2401406QRKRKT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024395529.10.0B3 domain-containing protein Os11g0197600-like
TrEMBLA9RXP50.0A9RXP5_PHYPA; Predicted protein
STRINGPP1S34_303V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP20511436
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.14e-15B3 family protein
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]