PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_19470V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family bZIP
Protein Properties Length: 291aa    MW: 31792.6 Da    PI: 6.8968
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_19470V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_131.15e-10126170751
                         HHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   7 errkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                          +r   NReA r++R++Kka ++ Lee v  L + N++L k+l+ 
  Pp3c14_19470V3.1.p 126 KKRPLGNREAVRKYREKKKAHTAYLEEQVHHLRGLNQQLVKRLQG 170
                         577788**********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1706.3E-13115188No hitNo description
SMARTSM003381.3E-10120187IPR004827Basic-leucine zipper domain
PfamPF077163.0E-14124176IPR004827Basic-leucine zipper domain
CDDcd146865.71E-12126178No hitNo description
SuperFamilySSF579591.25E-7126170No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MACRRRMDSP PMLCKTSADN PEGVIRGRGY QMDDGELEFT DHDVFAGCSL CDLPSTPTTM  60
GSMENFLEEV LRSTHACTHT HTCNPPGPDN THTHTCYHTH THLFAAGEED TSADKSETPT  120
SSHNSKKRPL GNREAVRKYR EKKKAHTAYL EEQVHHLRGL NQQLVKRLQG QASLESEVIR  180
LRSLLSEFRG RIDAEIGSFP VQASKCPTSS ALVTKSLPNG DCEVQSLSGG FCVNTVTVPC  240
VTDVPCLHTA TSGNSLARPP MTPSSEPAKW NRNSPMSDCV LSDSTVMHLS *
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.106520.0protonema
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the response to zinc ion deficiency. Binds to the consensus sequence 5'-[AG]TGTCGACA[CT]-3' also called zinc deficiency response element (ZDRE). The ZDRE sequence is conserved in the plant kingdom and present in the promoters of genes that constitute the primary response to zinc deficiency, comprising additional ZIP metal transporter genes (PubMed:20479230, PubMed:26306426). Required for zinc accumulation in roots. Mediates the expression of the zinc transporter ZIP12 during growth in zinc-deficient conditions. ZIP12 transporter is involved in zinc uptake in roots (PubMed:26306426). {ECO:0000269|PubMed:20479230, ECO:0000269|PubMed:26306426}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by zinc deficiency. {ECO:0000269|PubMed:20479230}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024394677.10.0basic leucine zipper 23-like isoform X1
SwissprotQ8GTS22e-60BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A2K1JID90.0A0A2K1JID9_PHYPA; Uncharacterized protein
STRINGPP1S34_90V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP19701536
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.19e-53bZIP family protein
Publications ? help Back to Top
  1. Azevedo H, et al.
    Transcriptomic profiling of Arabidopsis gene expression in response to varying micronutrient zinc supply.
    Genom Data, 2016. 7: p. 256-8
    [PMID:26981422]
  2. Castro PH, et al.
    Phylogenetic analysis of F-bZIP transcription factors indicates conservation of the zinc deficiency response across land plants.
    Sci Rep, 2017. 7(1): p. 3806
    [PMID:28630437]
  3. Nazri AZ,Griffin JHC,Peaston KA,Alexander-Webber DGA,Williams LE
    F-group bZIPs in barley-a role in Zn deficiency.
    Plant Cell Environ., 2017. 40(11): p. 2754-2770
    [PMID:28763829]
  4. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]