PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_15980V3.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 781aa    MW: 85465.4 Da    PI: 5.9717
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_15980V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox67.91.3e-2195150156
                         TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         +++ +++t+ q++e+e lF+++++p+ ++r++L+k lgL+ rqVk+WFqNrR+++k
  Pp3c14_15980V3.3.p  95 KKRYHRHTPRQIQEMEMLFKECPHPDDKQRQQLSKDLGLEPRQVKFWFQNRRTQMK 150
                         688999***********************************************998 PP

2START211.43.4e-662915122206
                         HHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S....EEE CS
               START   2 laeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                         la  a++elv++a+aeep+W ++     ++n+de++++f+++ +      + ea r++++v m+ ++lve+l+d   qW  +++    +a 
  Pp3c14_15980V3.3.p 291 LAMMAMEELVRMAQAEEPLWLSMDsgkAQLNYDEYMRQFPRGIGmrpsgLKPEATRETALVMMNGVNLVETLMDAT-QWMDMFPcmvsRAL 380
                         566799******************9999*************999*****9**************************.************** PP

                         EEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEE CS
               START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskv 164
                         t++v+s+g      galqlm+aelq+lsplvp R+ +f+Ry++q+ +g+w++vdvSvds +++p  +s++R++++pSg li++++ng+ kv
  Pp3c14_15980V3.3.p 381 TVDVLSTGvtgnrnGALQLMYAELQVLSPLVPtREIYFLRYCKQHAEGVWAVVDVSVDSLRDNP-PPSLMRCRRRPSGVLIQDTPNGYAKV 470
                         ****************************************************************.7************************* PP

                         EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
               START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         t veh+++++r +h ++r lv++g+a+ga++w+atlqrqce+
  Pp3c14_15980V3.3.p 471 TCVEHMEYDDRAVHRMYRELVNTGMAFGAQRWLATLQRQCER 512
                         ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.1E-2374150IPR009057Homeodomain-like
SuperFamilySSF466895.43E-2078152IPR009057Homeodomain-like
PROSITE profilePS5007117.18492152IPR001356Homeobox domain
SMARTSM003896.2E-2093156IPR001356Homeobox domain
CDDcd000862.91E-1994152No hitNo description
PfamPF000463.8E-1995150IPR001356Homeobox domain
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PROSITE profilePS5084846.779281515IPR002913START domain
SuperFamilySSF559614.3E-37282514No hitNo description
CDDcd088755.61E-131285511No hitNo description
SMARTSM002342.7E-59290512IPR002913START domain
PfamPF018522.9E-56292512IPR002913START domain
Gene3DG3DSA:3.30.530.204.8E-5385511IPR023393START-like domain
SuperFamilySSF559611.1E-24534772No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 781 aa     Download sequence    Send to blast
MLSFGELGGM PTGAMAPPRQ IPPLAMPRPP PKHYSSPSLS LGPPTGLDGQ REVSQTADNE  60
QQQKNKEEEY ESRSGSDNME GGSGDEDPDN NHPRKKRYHR HTPRQIQEME MLFKECPHPD  120
DKQRQQLSKD LGLEPRQVKF WFQNRRTQMK AQTERAENSM LRAENEKVRS ENLIMREALK  180
NPQCPHCGGP ATVGEMTFDE QQLRIENVRL KEELDRVSAL AAKYLGRPIT PMAPLALPSS  240
SLDLQVGGGS SFGGMHPTPG NLDLVAGPSV ADVATRPGGL TEAEKPMVVE LAMMAMEELV  300
RMAQAEEPLW LSMDSGKAQL NYDEYMRQFP RGIGMRPSGL KPEATRETAL VMMNGVNLVE  360
TLMDATQWMD MFPCMVSRAL TVDVLSTGVT GNRNGALQLM YAELQVLSPL VPTREIYFLR  420
YCKQHAEGVW AVVDVSVDSL RDNPPPSLMR CRRRPSGVLI QDTPNGYAKV TCVEHMEYDD  480
RAVHRMYREL VNTGMAFGAQ RWLATLQRQC ERLASLLASN IASRDLGGVP SASGRRSMLK  540
LAQRMTNNFC AGVSASTVHT WTTLSGSGDD DVRVMTRKSV DNPGEPHGIV LSAATSMWLP  600
VSPARVFQFL RDERLRSEWD ILSNGGIVTE MAHIAKGQDP GNSVSLLRVN AMNSNQSNML  660
ILQESCTDVS GSLVIYAPVD IPAMNLVLQG GDPAYVALLP SGFAILPDGP GGERGSLGVD  720
QGSQLTESSR GTGSLLTVAF QILVSSIPSA RLSLESVATV NNLISCTVQR IKSALLVEDA  780
*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.182641e-98protonema
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Specifically expressed in the layer 1 (L1) of shoot meristems. {ECO:0000269|PubMed:12505995}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds to the L1 box DNA sequence 5'-TAAATG[CT]A-3'. Plays a role in maintaining the identity of L1 cells, possibly by interacting with their L1 box or other target-gene promoters. Functionally redundant to ATML1. {ECO:0000269|PubMed:12505995}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024394840.10.0homeobox-leucine zipper protein HDG2-like isoform X2
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A2K1JI100.0A0A2K1JI10_PHYPA; Uncharacterized protein
STRINGPP1S209_10V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Prigge MJ,Clark SE
    Evolution of the class III HD-Zip gene family in land plants.
    Evol. Dev., 2006 Jul-Aug. 8(4): p. 350-61
    [PMID:16805899]
  3. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]