PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c14_13110V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GRAS
Protein Properties Length: 683aa    MW: 77070 Da    PI: 6.2472
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c14_13110V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.51.6e-1012986722373
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cA+a++ +d + aq+++  ++++a+ dgdp+qRl a+f++AL  r ++ +++l       +t+++   +++  l+ + +v P+++
  Pp3c14_13110V3.1.p 298 EQLLVQCATALEVSDITYAQQTIFVINNIAAADGDPNQRLLAHFLRALILRASKFTPHLLPGNDNPHTKSR-KLKTVLELTNYIDVMPWYR 387
                         79****************************************************99988866644444433.3334444456********* PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg...skeeleetgerLakfAeelgvpfefnv 180
                         f++++aN aIlea+eg+e+vHi+D++is+++QWp+L+++La+R+egpp+lR+T+++s+++        + e+  rLakfA++ +vpfe+++
  Pp3c14_13110V3.1.p 388 FGFIAANGAILEAFEGKEKVHILDLNISHCMQWPTLIESLAERNEGPPQLRLTVCVSKAPIpplLDVPYDELIIRLAKFARSKNVPFEYQL 478
                         *********************************************************888898888899*********************9 PP

                GRAS 181 lvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfd 269
                          + +++e+l+++++ +++gE+laVn+ ++lh++ de ++l+   +r+evL ++++l+P +v+++e +a+++s+++++r+  a++y++  fd
  Pp3c14_13110V3.1.p 479 -LFEDIEKLDVSKIGIREGEVLAVNCLFRLHYVTDECTELSTlsPREEVLYFIRKLNPAIVTLTEDDASLTSPKLVTRLKAAFNYFWIPFD 568
                         .6999******************************988777666*********************************************** PP

                GRAS 270 sleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslv 359
                         +l++ lp+e ++r   E e ++++i+n++aceg++r+er e + +W +r+++a F+ v++se+++++ kl+l +++  +g r +e+++ l+
  Pp3c14_13110V3.1.p 569 ALHTLLPKECQQRLHCEDE-VANKIENLIACEGKHRIERVEAKDRWVQRMKRARFHMVSFSEDVVTENKLMLGEHSgCWGLRKDEDEDVLF 658
                         *******************.99******************************************************9************** PP

                GRAS 360 lgWkdrpLvsvSaW 373
                         l+Wk++++ + +aW
  Pp3c14_13110V3.1.p 659 LTWKGHNVSFSTAW 672
                         ************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098548.073271652IPR005202Transcription factor GRAS
PfamPF035145.6E-99298672IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MEHQKGLSND TDSKTSNASS KAEHESTGFS ATPDKRLSSS VFDASLDASQ LDLDSHLDAL  60
RSQNCRMDNN PLGSDCDILW NQMQLQSHKM MPLSCLASDQ RPRSIMSRDR FGISSSIENY  120
TDSSLFRLSS NLGGAPQSIV KPELLWNKCE EFAHDAFTES TTSPGEMASK FLNMQTSRQG  180
YMPVQIASSS GTHAEAEVNP PAEKKMRSMM RMPIVGKQEY SLDPIQCPQE PGQVPIFQGE  240
ALESFMLSNT TKYILPPQSA ELEKQQRRRS EEKAKRIQVL GVRGVGSVMG TRELNTMEQL  300
LVQCATALEV SDITYAQQTI FVINNIAAAD GDPNQRLLAH FLRALILRAS KFTPHLLPGN  360
DNPHTKSRKL KTVLELTNYI DVMPWYRFGF IAANGAILEA FEGKEKVHIL DLNISHCMQW  420
PTLIESLAER NEGPPQLRLT VCVSKAPIPP LLDVPYDELI IRLAKFARSK NVPFEYQLLF  480
EDIEKLDVSK IGIREGEVLA VNCLFRLHYV TDECTELSTL SPREEVLYFI RKLNPAIVTL  540
TEDDASLTSP KLVTRLKAAF NYFWIPFDAL HTLLPKECQQ RLHCEDEVAN KIENLIACEG  600
KHRIERVEAK DRWVQRMKRA RFHMVSFSED VVTENKLMLG EHSGCWGLRK DEDEDVLFLT  660
WKGHNVSFST AWLPANPLLP LR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B2e-5629867488474Protein SHORT-ROOT
5b3h_B4e-5729867434420Protein SHORT-ROOT
5b3h_E4e-5729867434420Protein SHORT-ROOT
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.177020.0protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024394257.10.0scarecrow-like protein 32
TrEMBLA0A2K1JHL80.0A0A2K1JHL8_PHYPA; Uncharacterized protein
STRINGPP1S36_131V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP24991534
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-111GRAS family protein