PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c13_8880V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family MYB
Protein Properties Length: 1217aa    MW: 134610 Da    PI: 5.2814
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c13_8880V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.53.6e-09518562246
                        SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
    Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        ++WT+ Ed++l+  v+ + +  W++Ia+++ + Rt+ qc  r+q 
  Pp3c13_8880V3.1.p 518 KPWTKAEDKKLLSIVQAHDMVEWAAIAEELDTQRTPAQCAIRYQR 562
                        69*****************************99**********96 PP

2Myb_DNA-binding50.64.3e-16570616148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        r +WT+eEde+l  av+++G ++W ++a++m  gR + qc srw k+l
  Pp3c13_8880V3.1.p 570 RSAWTPEEDEQLQAAVEKFGEKDWQSVAACME-GRLGSQCMSRWTKVL 616
                        789*****************************.***********9975 PP

3Myb_DNA-binding506.8e-16623669148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
    Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                        rgrW +eEd +l+ av  +G++ Wk Ia++++ gR++ qc++rw ++l
  Pp3c13_8880V3.1.p 623 RGRWLAEEDTRLKWAVSVYGPRGWKNIAAHVP-GRSDVQCRERWCNVL 669
                        89******************************.***********9975 PP

4Myb_DNA-binding40.56.1e-13677717345
                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         W++eEd +l ++v ++G ++W+++ +++g  Rt++qc  +w 
  Pp3c13_8880V3.1.p 677 EWSPEEDAKLEELVVKYGRHRWAAVGAELG--RTDNQCFRHWK 717
                        7****************************8..**********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.0014423513IPR001005SANT/Myb domain
PROSITE profilePS500905.784426511IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.608.8E-7426442IPR009057Homeodomain-like
CDDcd001670.00394475510No hitNo description
Gene3DG3DSA:1.10.10.608.8E-7483521IPR009057Homeodomain-like
SuperFamilySSF466892.51E-14494565IPR009057Homeodomain-like
PROSITE profilePS500909.361512564IPR017877Myb-like domain
SMARTSM007173.0E-8516566IPR001005SANT/Myb domain
CDDcd001675.91E-7519564No hitNo description
PfamPF139214.8E-15520581No hitNo description
Gene3DG3DSA:1.10.10.601.8E-12522572IPR009057Homeodomain-like
SuperFamilySSF466896.82E-17550618IPR009057Homeodomain-like
PROSITE profilePS5129415.872565617IPR017930Myb domain
SMARTSM007171.2E-14569618IPR001005SANT/Myb domain
CDDcd001671.78E-12572616No hitNo description
Gene3DG3DSA:1.10.10.603.8E-16573619IPR009057Homeodomain-like
SuperFamilySSF466891.12E-18596669IPR009057Homeodomain-like
PROSITE profilePS5129425.201618673IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.2E-18620672IPR009057Homeodomain-like
SMARTSM007173.5E-14622671IPR001005SANT/Myb domain
PfamPF002494.1E-14623669IPR001005SANT/Myb domain
CDDcd001672.58E-11625669No hitNo description
SuperFamilySSF466893.66E-22649720IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-14673717IPR009057Homeodomain-like
PROSITE profilePS5129414.962674723IPR017930Myb domain
SMARTSM007177.7E-13674722IPR001005SANT/Myb domain
CDDcd001675.59E-11677719No hitNo description
PfamPF002491.5E-11677717IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1217 aa     Download sequence    Send to blast
MAYERGLSRV LDDDDEDDDV ADLFDDEFLE HIEALKQACQ MLPGAEVRLK SSSTLAASKF  60
GEEEYEEEGD GEVDDDDDDD DDALLLSIER KFLGKGGLVS GPVRSKAVPA KERITPRASS  120
ECEERQGVAK DGGITGTTAR RPSVPETDGV SQSLRRSAPV CENSSDDEDE DLLRSVKESC  180
GALDLVKASK HEKTTLSNPP SLAVGDVERE VLSGVVVPTF RGLDTESARD ERCANSTAEE  240
DKASVPGVEA VSSDNAQAIA RSEGAGWNTA IVDTVDELQN FLPAQLSDDE FDENPLALTI  300
HDTKLGSCGG KTKVPENVQA VTDALLKNRL CQQTLRDVLQ KVERKLSENK EMQRRAVSLV  360
EYQKACTRKF CGFTEVVNSS VELIATKPAS KKKSGEFKVR GPPENPDVEI YRKLQSQLPA  420
EFNVKKWTKK ETQALSKGVR QQLQEIRLRA MMEGWDSDEE GQDFDEQMRT IGENEEELKK  480
GLPFIDWNEV ARIYVSGRSA WECKLQWENN ENPLLNSKPW TKAEDKKLLS IVQAHDMVEW  540
AAIAEELDTQ RTPAQCAIRY QRSLNAAILR SAWTPEEDEQ LQAAVEKFGE KDWQSVAACM  600
EGRLGSQCMS RWTKVLHPDR HRRGRWLAEE DTRLKWAVSV YGPRGWKNIA AHVPGRSDVQ  660
CRERWCNVLD PSVKIDEWSP EEDAKLEELV VKYGRHRWAA VGAELGRTDN QCFRHWKLLH  720
PEHKISFKKD MAIRRAALAN NFVGREKERP DLGFQDFLPP PVAGEEEHNH PASPKSLTTS  780
TENAVRKSGK RPSKKRKTPE LVSQSTDNFP TETEVQAVVV DCADGSNSMP LNSSNGAMRR  840
QAARPGGNAI KKRKLQVSTS TDENILVEKE LQRAEGIASN GNQEVRVRSL KKSRPKKAPK  900
PVELSSKKMK SMELASETND DLPIQTDLQI IEVASADGSN VAPLNSTKKS KKRRSSNPGE  960
RAAKKRKTPE LVSAITENLL IEKDLQSVEV DSSNGNNAAP VNSVEESARI PGSKLLCRRK  1020
KSPKRRVKTS TKTRIPELAL VLEEMLPIQN RVPSAGEVSG DGVSNDSMVT TVEGARETSS  1080
VNGNYAQEPF VRGDTGNGGG ASDADLVEHR TNPILVSNVI CSPCNDAVKE KRDEEDAELI  1140
VYTRRKNRVS SCSRTCSENT GAVELSATGT VTSGVGQDGR VHETDTTAGE LIQEPILRRS  1200
RKKLTLPDFL YSGSKD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C1e-284867226159MYB PROTO-ONCOGENE PROTEIN
1h88_C1e-284867226159MYB PROTO-ONCOGENE PROTEIN
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1951966KRRSSNPGERAAKKRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGPP1S52_54V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP73551617
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-101myb domain protein 4r1