PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c13_8760V3.4.p
Common NamePHYPADRAFT_163123, PpLFY1, PPLFY1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LFY
Protein Properties Length: 350aa    MW: 40263 Da    PI: 7.2249
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c13_8760V3.4.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY473.71.1e-1443034739385
            FLO_LFY  39 aaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrr 130
                          +a   r+ r+l+elfk++Gv+ +tva ++++Gft stL++mkdee+d ++ks++e ++ldll+Ge++Gikaavra+rr +eee  e++r+
  Pp3c13_8760V3.4.p  30 DGVALVGRENRRLKELFKDFGVQPSTVAVMGQMGFTLSTLINMKDEEVDFVIKSMIEEYHLDLLMGEQFGIKAAVRAKRRLVEEEM-EQQRM 120
                        55667788899******************************************************************999888754.66666 PP

            FLO_LFY 131 kll.sedeetaldalsqeglseepvqeekeaagsggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsg 221
                         l   ++e++     s++gl            + g+++l++ +l++ ++ +s++e kk +k++q+++++ke                    g
  Pp3c13_8760V3.4.p 121 DLAaRSNEKKRRLEESSDGL----------LLKDGNGSLEALGLLGLTDPDSDSEGKKVAKRRQRKRRSKE-------------------VG 183
                        44322222222222333332..........23334555668999999999999999999887777777766...................89 PP

            FLO_LFY 222 edgeerqrehPfivtepgevargkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhc 313
                        edgeer+rehPfivtepge a+gkknGLDYLfdLyeqC++fL +vq+iake+GekcP+kvtn+vfr+ak +ga yinkPkmr+YvhCYalhc
  Pp3c13_8760V3.4.p 184 EDGEERPREHPFIVTEPGEPAKGKKNGLDYLFDLYEQCGKFLEEVQHIAKEKGEKCPSKVTNEVFRHAKLTGAGYINKPKMRDYVHCYALHC 275
                        99****************************************************************************************** PP

            FLO_LFY 314 LdeeasnalrrafkergenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerska 385
                        Ld e+sn+lr+++kergenvGaw+qacy plv++a++++wdid +fn++++L+iWYvPtkLrqLCh+er+k+
  Pp3c13_8760V3.4.p 276 LDVETSNNLRKEYKERGENVGAWCQACYFPLVKLARQNEWDIDDLFNRNDKLRIWYVPTKLRQLCHIERMKH 347
                        *********************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016985.0E-11529347IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MVDDCPVHNM QAQFDIVQAE PTALLYKRPD GVALVGRENR RLKELFKDFG VQPSTVAVMG  60
QMGFTLSTLI NMKDEEVDFV IKSMIEEYHL DLLMGEQFGI KAAVRAKRRL VEEEMEQQRM  120
DLAARSNEKK RRLEESSDGL LLKDGNGSLE ALGLLGLTDP DSDSEGKKVA KRRQRKRRSK  180
EVGEDGEERP REHPFIVTEP GEPAKGKKNG LDYLFDLYEQ CGKFLEEVQH IAKEKGEKCP  240
SKVTNEVFRH AKLTGAGYIN KPKMRDYVHC YALHCLDVET SNNLRKEYKE RGENVGAWCQ  300
ACYFPLVKLA RQNEWDIDDL FNRNDKLRIW YVPTKLRQLC HIERMKHGE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4bhk_A1e-1261813484171FLORICAULA/LEAFY HOMOLOG 1
4bhk_B1e-1261813484171FLORICAULA/LEAFY HOMOLOG 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1166173KKVAKRRQ
2173178QRKRRS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1650.0protonema
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in both male and female cones, vegetative buds and needles, but not in the roots.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0522510.0AB052251.1 Physcomitrella patens PPLFY1 mRNA for FLORICAULA/LEAFY homolog 1, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024391907.10.0floricaula/leafy-like protein FL1 isoform X1
SwissprotO044071e-135NEED_PINRA; Floricaula/leafy-like protein FL1
TrEMBLQ94IF50.0Q94IF5_PHYPA; FLORICAULA/LEAFY homolog 1
STRINGPP1S52_67V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.13e-84floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Himi S, et al.
    Evolution of MADS-box gene induction by FLO/LFY genes.
    J. Mol. Evol., 2001 Oct-Nov. 53(4-5): p. 387-93
    [PMID:11675598]
  2. Tanahashi T,Sumikawa N,Kato M,Hasebe M
    Diversification of gene function: homologs of the floral regulator FLO/LFY control the first zygotic cell division in the moss Physcomitrella patens.
    Development, 2005. 132(7): p. 1727-36
    [PMID:15743879]
  3. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]
  4. Sayou C, et al.
    A promiscuous intermediate underlies the evolution of LEAFY DNA binding specificity.
    Science, 2014. 343(6171): p. 645-8
    [PMID:24436181]