PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c13_6470V3.8.p
Common NamePpVNS1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 374aa    MW: 42417 Da    PI: 6.6746
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c13_6470V3.8.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.57.9e-5181372128
                NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk......kvkaeekewyfFskrdkkyatgkrknratksgyWkatg 87 
                        p+GfrFhPtdeelv +yL+ kv + + +    i+e+d+yk+ePwdL++       + +++++wyfFs++dkky+tg+r+nrat++g+Wkatg
  Pp3c13_6470V3.8.p   8 PVGFRFHPTDEELVGYYLHGKVGRFQRDQ--LIQELDLYKIEPWDLHEvcrigdDAPEHQSDWYFFSHKDKKYPTGNRANRATTAGFWKATG 97 
                        89********************9887544..8**************854655554444777******************************* PP

                NAM  88 kdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        +dk++++ +++++g++ktLvfykgrap+g+ktdW+mhe+rl
  Pp3c13_6470V3.8.p  98 RDKPIHT-QRQVIGMRKTLVFYKGRAPNGQKTDWIMHEFRL 137
                        *******.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.31E-545160IPR003441NAC domain
PROSITE profilePS5100554.8677160IPR003441NAC domain
PfamPF023657.7E-278137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 374 aa     Download sequence    Send to blast
MNNKAPIPVG FRFHPTDEEL VGYYLHGKVG RFQRDQLIQE LDLYKIEPWD LHEVCRIGDD  60
APEHQSDWYF FSHKDKKYPT GNRANRATTA GFWKATGRDK PIHTQRQVIG MRKTLVFYKG  120
RAPNGQKTDW IMHEFRLDDC PGASPNYESD GWVVCRVFRK MKNFKTKSQE TSCSLEEDQV  180
LLPELMSHSE GGGGPSSQGG EVQYNPHLHH FSFTCKQELS VEDYRTPISS DPFMENLHLH  240
ELHRSIEPSC HQNYLPPSVS STFRSLQPAC TSGRSSRDYA EYSLVPFPLE STSLRDFDDA  300
RSSVTQDGSS LTALAHHNDA EYWMLDGGIS KAGARRDQTL AAVTYHVDLK SRQSSDNSSA  360
STNHEGFGHL WNV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B1e-45716017165NAC domain-containing protein 19
4dul_A1e-45716017165NAC domain-containing protein 19
1ut7_B1e-45716017165NO APICAL MERISTEM PROTEIN
1ut7_A1e-45716017165NO APICAL MERISTEM PROTEIN
1ut4_B1e-45716017165NO APICAL MERISTEM PROTEIN
1ut4_A1e-45716017165NO APICAL MERISTEM PROTEIN
3swp_D2e-45716020168NAC domain-containing protein 19
3swp_C2e-45716020168NAC domain-containing protein 19
3swp_B2e-45716020168NAC domain-containing protein 19
3swp_A2e-45716020168NAC domain-containing protein 19
3swm_D2e-45716020168NAC domain-containing protein 19
3swm_C2e-45716020168NAC domain-containing protein 19
3swm_B2e-45716020168NAC domain-containing protein 19
3swm_A2e-45716020168NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.147090.0protonema| sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8980810.0AB898081.1 Physcomitrella patens PpVNS1 mRNA for NAC transcription factor PpVNS1, complete cds, ecotype: Gransden 2004.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLX5II810.0X5II81_PHYPA; NAC transcription factor PpVNS1
STRINGPP1S182_37V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.12e-74NAC 007
Publications ? help Back to Top
  1. Xu B, et al.
    Contribution of NAC transcription factors to plant adaptation to land.
    Science, 2014. 343(6178): p. 1505-8
    [PMID:24652936]