PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c13_21190V3.1.p
Common NamePHYPADRAFT_161886
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 712aa    MW: 74345.9 Da    PI: 5.9318
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c13_21190V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.94.6e-38269328261
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                         ++k  +cprCds +tkfCyynny+ +qPr+fCk+C+ryWt+GG+lrnvPvG+grrk k+ 
  Pp3c13_21190V3.1.p 269 PDKLAPCPRCDSLDTKFCYYNNYNANQPRHFCKNCQRYWTAGGTLRNVPVGAGRRKTKHG 328
                         78899***************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.4E-31271327IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.407273327IPR003851Zinc finger, Dof-type
PROSITE patternPS013610275311IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-23277326IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 712 aa     Download sequence    Send to blast
MGSSSHENGG DEPRVSKPAT VFLGDLSLSG EGPGFCGYSG PTHANTVNYD LGSHKEHYLH  60
QPQPEGEKGG LADRMNRNKV ILGQQPSLIS KDAEGQTTGL ELNASEVKTH LSCENPITND  120
VEDDDDGLSG AADKLQGDVA GVHEIVVTPF PLSSEKQESE TEPLDSIHLK SNSGDVVADG  180
SSLELANELQ NEVPGVSGLD QSAGTEALGP PQHQTAKLEE GTVGRRPLAV ADNEDTVGSV  240
RPPPVDGDLV GPSPKQAKVQ HQKPALKKPD KLAPCPRCDS LDTKFCYYNN YNANQPRHFC  300
KNCQRYWTAG GTLRNVPVGA GRRKTKHGNS HVRHGGLLDI PAARQDSDMA LSRPCLSRGA  360
SVPDQVSPLP ASSSSSPSTI TSLPSSQDRS SSDAVTQTCS MRPAEAVRKH HIPEPQVNVS  420
GDSGNRLLKA EHGGGCEPVL AGEAENCAEA CTSSLPGSPQ VDAALASQEV QSMLRGPPTT  480
LIPVCGGIVR PVGILDGSVW TAAPTPFGLF NGSWPYGYNV GWSGPAPGAP GAPTCPPGGT  540
LVSCQPAVAW SAPPNGLWSN VCWGSTLIPG MPAGLPGPSW MSPGWGAGWP MPWGPDAAAA  600
AAAAASASMQ VPAVPMSGNV SPVQSRLPIR PVLNKHPRDR PELERVESSL WVPKMVKIDD  660
AVNTPRSSVW TAVGAENRVE TVASGSNFKA FLPVGDNKVS ITSGDRKQVK S*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.48690.0gametophore| protonema| sporophyte
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6266990.0AB626699.1 Physcomitrella patens PpDof3 mRNA for Dof transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024392472.10.0uncharacterized protein LOC112290457 isoform X1
RefseqXP_024392473.10.0uncharacterized protein LOC112290457 isoform X1
RefseqXP_024392474.10.0uncharacterized protein LOC112290457 isoform X1
TrEMBLA0A2K1JN530.0A0A2K1JN53_PHYPA; Uncharacterized protein
STRINGPP1S37_7V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.13e-30cycling DOF factor 3
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]