PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c13_20650V3.3.p
Common NamePpVNS5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 382aa    MW: 43260.2 Da    PI: 6.6493
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c13_20650V3.3.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM161.92.4e-5081401128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk......kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                         +p+GfrFhPtdeelv +yL  +v+++k+el + i+++d+yk+ePwdL+         +++++++yfFs++dkky+tg+r+nrat++g+Wka
  Pp3c13_20650V3.3.p   8 VPVGFRFHPTDEELVGYYLPMRVTARKVEL-DLIRDLDLYKLEPWDLQDlckiqaDSNEKQTDYYFFSRKDKKYPTGNRANRATTQGFWKA 97 
                         599************************999.99**************94465533222344577*************************** PP

                 NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         tg+dk++++k ++l+g++ktLvfy+grap+g+ktdW+mhe+rl
  Pp3c13_20650V3.3.p  98 TGRDKPIHTKLQTLIGMRKTLVFYQGRAPHGVKTDWIMHEFRL 140
                         *********9999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.01E-536162IPR003441NAC domain
PROSITE profilePS5100553.9318162IPR003441NAC domain
PfamPF023652.6E-259140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 382 aa     Download sequence    Send to blast
MNQLTAKVPV GFRFHPTDEE LVGYYLPMRV TARKVELDLI RDLDLYKLEP WDLQDLCKIQ  60
ADSNEKQTDY YFFSRKDKKY PTGNRANRAT TQGFWKATGR DKPIHTKLQT LIGMRKTLVF  120
YQGRAPHGVK TDWIMHEFRL DDGPGQPAHV NDGWVVCRVF KKNKNQKPKV EERAVSHEEH  180
MGTLPSEHMG SPDILSGGGR FAYSDQSQYG SIKQEIISLD EYKSRHSDMY LNQFSGQMAL  240
LSNAETQSRS MPSSSILNQS RSHTCLTLSP RRPDCYQNFN SYLETPAYPE NSTEYTDPQS  300
SGSGSDGETH EDSILGNLDN LDWSALLQEP SSGKDSRCPP TASAKANTED VTALIQIKRQ  360
NSDIFSSLDL WNYSHVAQQT L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-44816715174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB8980850.0AB898085.1 Physcomitrella patens PpVNS5 mRNA for NAC transcription factor PpVNS5, complete cds, ecotype: Gransden 2004.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLX5IYJ70.0X5IYJ7_PHYPA; NAC transcription factor PpVNS5
STRINGPP1S223_12V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.14e-73NAC 007
Publications ? help Back to Top
  1. Xu B, et al.
    Contribution of NAC transcription factors to plant adaptation to land.
    Science, 2014. 343(6178): p. 1505-8
    [PMID:24652936]