PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c13_2000V3.1.p
Common NamePpDof6
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 646aa    MW: 68314.9 Da    PI: 7.6502
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c13_2000V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.63.2e-39211269260
             zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                        ++k ++cprCds +tkfCyynny+++qPr+fCk+C+ryWt+GG+lrnvPvG+grrknk+
  Pp3c13_2000V3.1.p 211 PDKVVSCPRCDSLDTKFCYYNNYNINQPRHFCKNCQRYWTAGGTLRNVPVGAGRRKNKH 269
                        78999****************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-29208268IPR003851Zinc finger, Dof-type
PfamPF027013.4E-32212269IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.602215269IPR003851Zinc finger, Dof-type
PROSITE patternPS013610217253IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009658Biological Processchloroplast organization
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 646 aa     Download sequence    Send to blast
MSSDNLSERR EGLLLPSANP KFCQGVGRWI LQDQAVSDFV YQRLPLGGEG VALDVVEQAS  60
MPHPCDWTLG VQPGCPKASV DPQIKLFGQT IGVVSSRADA GADAGVLKPT SASPPRGTAP  120
LSKQDGGDSV ILRDENEGGV VENLRTARSS SRDEFLQPLK SSELVSGSRS LNTGVSLGPS  180
DSEGAHSDEL KDQGEVDHSQ SVGDDKHLQK PDKVVSCPRC DSLDTKFCYY NNYNINQPRH  240
FCKNCQRYWT AGGTLRNVPV GAGRRKNKHG GMQRDCPEAS VNCSIQSDSG DSASQLLSCA  300
LGSPTSQKAG SSLKHAQPKR LAGQGSPMRS SGFGQDNGIS ISPPYSLHQN SRLPFQSFSL  360
SQGFMPSAVE ASTVGSSDSA SISLGQRLAR CPSGNGFDKD CSRSSLNGQT QDTHSLLSKQ  420
SAYNSSALQL EATSGMYRFV LPSSSSGWAG NGASVGFHSG EWPHGYHLEL GGKHPISHSS  480
QGVSYSTPDV RASLNAIQTL PPTSSWSPTL VQSGATQWGA DVGHVHNPPQ MAASVWPRSQ  540
SMVPSAASVG QAPVAAPTTL GKRGLLEEGS CEWPSKCLRT DDSKNLNTWA MPGKNSTEVM  600
NGGNALSLFR PKLELAVACE TKDSFMTRHL TTVAAARSGP FQVTI*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.10660.0gametophore| protonema
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB6267010.0AB626701.1 Physcomitrella patens PpDof6 mRNA for Dof transcription factor, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024393058.10.0uncharacterized protein LOC112290699
TrEMBLH1ACT20.0H1ACT2_PHYPA; Dof transcription factor
STRINGPP1S385_53V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62430.12e-35cycling DOF factor 1
Publications ? help Back to Top
  1. Sugiyama T, et al.
    Involvement of PpDof1 transcriptional repressor in the nutrient condition-dependent growth control of protonemal filaments in Physcomitrella patens.
    J. Exp. Bot., 2012. 63(8): p. 3185-97
    [PMID:22345635]