PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_5931V3.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family LBD
Protein Properties Length: 300aa    MW: 33404.4 Da    PI: 8.1642
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_5931V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.63.7e-42461461101
             DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlka 92 
                        aCaaCk++rrkCa+dC+lapyfp +qpk+f nvh+lFG+s +l++l+++++e+red+++s+vyeA+ r +dPv+G++gvi+ lq+q+++lk 
  Pp3c12_5931V3.2.p  46 ACAACKYQRRKCATDCPLAPYFPPDQPKRFLNVHRLFGVSSILRILRQVDPEKREDTVKSIVYEADTREKDPVHGCLGVIRLLQNQVNKLKD 137
                        7******************************************************************************************* PP

             DUF260  93 elallkeel 101
                        e+++++e+l
  Pp3c12_5931V3.2.p 138 EVVVAREQL 146
                        ***999885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.17245146IPR004883Lateral organ boundaries, LOB
PfamPF031951.9E-4046143IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MQRLKSLEDF SKMTAPPKIS PPGERSIVTG GAGPSSSGPS AGANAACAAC KYQRRKCATD  60
CPLAPYFPPD QPKRFLNVHR LFGVSSILRI LRQVDPEKRE DTVKSIVYEA DTREKDPVHG  120
CLGVIRLLQN QVNKLKDEVV VAREQLYLME QQHTSSILQQ NYGHQHAGGQ ADYHHYHLQP  180
QYRASTSHQG GSFHDPAHGQ NLTYQDSRSS HGAYSDHARY LVDSDSDLHG NSMLGQQIIK  240
DFNNALQQLR PSVFPNDLGI LDDWSRTFGG LALQSVHQLV QNFRMIQCSS NSFVSKFFD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A8e-36401465111LOB family transfactor Ramosa2.1
5ly0_B8e-36401465111LOB family transfactor Ramosa2.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024390324.10.0LOB domain-containing protein 6-like isoform X2
TrEMBLA0A2K1JPM20.0A0A2K1JPM2_PHYPA; Uncharacterized protein
STRINGPP1S56_77V6.11e-145(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.12e-33LOB domain-containing protein 25