PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_22390V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family Dof
Protein Properties Length: 383aa    MW: 41274.9 Da    PI: 8.2217
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_22390V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.27.4e-3845105262
              zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                         ++k l+cprC+s+ntkfCyynnys++qPr+fC++C+ryWt GG+lrnvPvGgg+rk+++++
  Pp3c12_22390V3.1.p  45 PQKVLPCPRCESMNTKFCYYNNYSVNQPRHFCRQCQRYWTVGGTLRNVPVGGGSRKKNRHQ 105
                         78999***************************************************98865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074789.0E-2542100IPR003851Zinc finger, Dof-type
PfamPF027013.1E-3247103IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.58449103IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105187IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MVHLPASKDD TSVGSLEKES RKLTLGATGT PASPASPGKK ALEKPQKVLP CPRCESMNTK  60
FCYYNNYSVN QPRHFCRQCQ RYWTVGGTLR NVPVGGGSRK KNRHQRQEPY LRTGPGSVGS  120
PLAMATAGGQ PGMPNMGFQQ LLTHDMSGFN FSQLPGFVPQ NHYPTYSVDH TQGMYTQPLS  180
SKTAQQEFQS MRPMYGTMIP HSMPPVTGNY YGPDLGSQLQ VDNAVNTNGT VGSVKPEFWG  240
NMVPQNPHPQ AGNHPVFSMW EQSNPTSATP ASAADQGAGK TGVPATLQTI PKNGGYDSSM  300
LLHLGLNSRP QLGGKPAAWN QNQLDSRGGT LPTNGSSPPH GSSTIEEEGS TPTNGYSNSG  360
YEEGDTVSSM WQDMHDMHDI FQ*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.100290.0gametophore| protonema| sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024391179.10.0dof zinc finger protein 1-like
TrEMBLA0A2K1JRQ10.0A0A2K1JRQ1_PHYPA; Uncharacterized protein
STRINGPP1S118_226V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP3817445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.12e-32cycling DOF factor 3