PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_21760V3.2.p
Common NamePHYPADRAFT_234989
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 346aa    MW: 38066.1 Da    PI: 4.5304
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_21760V3.2.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.32.7e-1899152356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++t +q++ Le+ Fe+++++  e++ +LAk+lgL  rqV vWFqNrRa++k
  Pp3c12_21760V3.2.p  99 KKRRLTFDQVRSLERNFEMENKLEPERKMQLAKELGLRPRQVAVWFQNRRARWK 152
                         45578999*********************************************9 PP

2HD-ZIP_I/II121.25.4e-3998190193
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ +qv++LE++Fe+e+kLeperK++la+eLgl+prqvavWFqnrRAR+ktkqlE+dyeaL + y++lk++ + + +e+++L++e+
  Pp3c12_21760V3.2.p  98 EKKRRLTFDQVRSLERNFEMENKLEPERKMQLAKELGLRPRQVAVWFQNRRARWKTKQLERDYEALAADYKSLKHDYDLVLAEKNNLKAEV 188
                         69**************************************************************************************999 PP

         HD-ZIP_I/II  92 ke 93 
                         ++
  Pp3c12_21760V3.2.p 189 QR 190
                         86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.2E-2078155IPR009057Homeodomain-like
SuperFamilySSF466891.11E-1985156IPR009057Homeodomain-like
PROSITE profilePS5007117.62194154IPR001356Homeobox domain
SMARTSM003896.2E-1497158IPR001356Homeobox domain
CDDcd000863.02E-1799155No hitNo description
PfamPF000461.1E-1599152IPR001356Homeobox domain
PRINTSPR000317.6E-6125134IPR000047Helix-turn-helix motif
PROSITE patternPS000270129152IPR017970Homeobox, conserved site
PRINTSPR000317.6E-6134150IPR000047Helix-turn-helix motif
PfamPF021834.7E-16154194IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000006anatomyplant protoplast
PO:0025017anatomyplant spore
PO:0030003anatomyprotonema
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MAITSMGGYP CQSAMQQLIR NESSSDSLAA ILTPCSPHVG LQAPPHVGGS LEDAVLVASE  60
GSRQKRPFFA TYDAPTVEDG PVEDDEGADD SQGASQLEKK RRLTFDQVRS LERNFEMENK  120
LEPERKMQLA KELGLRPRQV AVWFQNRRAR WKTKQLERDY EALAADYKSL KHDYDLVLAE  180
KNNLKAEVQR LSGKAPTSPC ADGNQIVAGE SAQTPEVDVE TSELVARQHT SRSTPTVDVS  240
LACVKDKDFE TSGCTDGNSS DVLDADSPRT TDSSSLSAMS DHDQLIYSHE IPPPESFMGL  300
SGMLHDVTVK LEEGSGHGFH DDNSSNYFLL HLEDQAGVLP WWDWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.1580.0gametophore| sporophyte
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0280770.0AB028077.1 Physcomitrella patens mRNA for homeobox protein PpHB6, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024391647.10.0homeobox-leucine zipper protein HAT5-like
RefseqXP_024391648.10.0homeobox-leucine zipper protein HAT5-like
RefseqXP_024391649.10.0homeobox-leucine zipper protein HAT5-like
TrEMBLA9SRK50.0A9SRK5_PHYPA; Predicted protein
STRINGPP1S108_47V6.10.0(Physcomitrella patens)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-40homeobox 1
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]