PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c12_18020V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family NAC
Protein Properties Length: 429aa    MW: 47278.6 Da    PI: 4.7652
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c12_18020V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.21.1e-55221501129
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrFhPtdeelv++yL++kv ++++ + ++i+evd++k+ePwdLp+k+k +ekewyfFs rd+ky+tg r+nrat++gyWkatgkd++
  Pp3c12_18020V3.1.p  22 LPPGFRFHPTDEELVSYYLTNKVLDSSFAV-HAIAEVDLNKCEPWDLPEKAKMGEKEWYFFSLRDRKYPTGIRTNRATDAGYWKATGKDRD 111
                         79*************************999.88***************99999************************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrle 129
                         v+++ +  lvg+kktLvfy+grapkgekt+W+mheyrle
  Pp3c12_18020V3.1.p 112 VFAHgRPPLVGMKKTLVFYRGRAPKGEKTSWIMHEYRLE 150
                         ***744456****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-6417174IPR003441NAC domain
PROSITE profilePS5100560.61122174IPR003441NAC domain
PfamPF023652.2E-2823149IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MATACLQGPQ GQVQSQHGEP FLPPGFRFHP TDEELVSYYL TNKVLDSSFA VHAIAEVDLN  60
KCEPWDLPEK AKMGEKEWYF FSLRDRKYPT GIRTNRATDA GYWKATGKDR DVFAHGRPPL  120
VGMKKTLVFY RGRAPKGEKT SWIMHEYRLE GDGGHSLSPR VNKDEWVVCR IFQKNSGGKG  180
SFLFSDSCMR SHAVMYQIED TRSSLPPVMN NNSPNPTVTD GGTCTDCETC AGTEQMPACY  240
NCVDDFDHGK ETNSVMSWIN AQSTGMDILQ QVGDLNNLSN MLSKQYPVYD AAYEKGMSLS  300
RQLGFTPQVL LQPANMTTPT GLRVTSLRPK TEPSSFSEGE DEAQSIPEGY GYDGWQAEDA  360
EASLYNNNDG TADDSSSPLQ SSTGGTELSC LSGSFCSGDH MNNFKYRLQD ITALADSGLG  420
TEILGWCC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swp_D5e-552217920173NAC domain-containing protein 19
3swp_C5e-552217920173NAC domain-containing protein 19
3swp_B5e-552217920173NAC domain-containing protein 19
3swp_A5e-552217920173NAC domain-containing protein 19
3swm_D5e-552217920173NAC domain-containing protein 19
3swm_C5e-552217920173NAC domain-containing protein 19
3swm_B5e-552217920173NAC domain-containing protein 19
3swm_A5e-552217920173NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.99451e-107protonema
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001761033.10.0predicted protein, partial
TrEMBLA9S3Z40.0A9S3Z4_PHYPA; Predicted protein (Fragment)
STRINGPP1S46_208V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53950.12e-83NAC family protein