PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c11_23440V3.1.p
Common NamePHYPADRAFT_120051
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 337aa    MW: 37452.5 Da    PI: 4.6915
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c11_23440V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.22.8e-1889142356
                         --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
            Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                         k++++t +q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pp3c11_23440V3.1.p  89 KKRRLTFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWK 142
                         45578999*********************************************9 PP

2HD-ZIP_I/II124.64.5e-4088179192
         HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                         ekkrrl+ +qv++LE++Fe e+kLeperK++la+eLglqprqvavWFqnrRAR+ktkqlE+dye+L + y++lk+e e++ +e++eL+ e+
  Pp3c11_23440V3.1.p  88 EKKRRLTFDQVRSLERNFEVENKLEPERKMQLAKELGLQPRQVAVWFQNRRARWKTKQLERDYEVLTSDYNRLKSEFEAVLQEKQELQGEI 178
                         69*************************************************************************************9988 PP

         HD-ZIP_I/II  92 k 92 
                         +
  Pp3c11_23440V3.1.p 179 E 179
                         6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-1979146IPR009057Homeodomain-like
PROSITE profilePS5007117.58984144IPR001356Homeobox domain
SMARTSM003891.7E-1487148IPR001356Homeobox domain
CDDcd000862.85E-1689145No hitNo description
PfamPF000461.2E-1589142IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.4E-1991151IPR009057Homeodomain-like
PRINTSPR000316.0E-6115124IPR000047Helix-turn-helix motif
PROSITE patternPS000270119142IPR017970Homeobox, conserved site
PRINTSPR000316.0E-6124140IPR000047Helix-turn-helix motif
PfamPF021831.5E-16144186IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001558Biological Processregulation of cell growth
GO:0009637Biological Processresponse to blue light
GO:0009651Biological Processresponse to salt stress
GO:0009965Biological Processleaf morphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0030018anatomygametophore
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MANNISRGGF GHGSSNVMLV RNESSTDTLV AMLASCSPAA LQVQRGGGGL EDALVSSGQK  60
RSFFPTFEAS GEDAGDEDLG DDCTHNVEKK RRLTFDQVRS LERNFEVENK LEPERKMQLA  120
KELGLQPRQV AVWFQNRRAR WKTKQLERDY EVLTSDYNRL KSEFEAVLQE KQELQGEIEC  180
LTGKLQISSQ PGPVDGAPEK PSKRLSKAVP SQLSPPKTSS EACVKSERKP SDPNASSNDD  240
KEEGSRATSS DSISSEILDA DSPRTTEKFN TDLAAEVPLD SNIIHVSDHL CDHMLYPQAC  300
QRISVKLEDG SFRDESCNYI LSQLDEERGL PWWDWP*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136144RRARWKTKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00323DAPTransfer from AT3G01470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024388198.10.0homeobox-leucine zipper protein HAT5-like
TrEMBLA0A2K1JVY60.0A0A2K1JVY6_PHYPA; Uncharacterized protein
STRINGPP1S31_96V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP12916189
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.13e-45homeobox 1
Publications ? help Back to Top
  1. Rensing SA, et al.
    The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants.
    Science, 2008. 319(5859): p. 64-9
    [PMID:18079367]