PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c10_22600V3.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family GATA
Protein Properties Length: 477aa    MW: 51800.1 Da    PI: 5.5198
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c10_22600V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA52.47e-17294328135
                GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                         C +C+t  Tp+WR gp g+ktLCnaCG++y++ +l
  Pp3c10_22600V3.1.p 294 CMHCQTQRTPQWRTGPMGPKTLCNACGVRYKSGRL 328
                         99*****************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004019.6E-14288338IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.424288324IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-14289351No hitNo description
CDDcd002021.04E-12293340No hitNo description
Gene3DG3DSA:3.30.50.106.4E-14293326IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.3E-14294328IPR000679Zinc finger, GATA-type
PROSITE patternPS003440294319IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 477 aa     Download sequence    Send to blast
MVSPYVLAGG FGSYGHPEVD KPALPEFFHI DDLLDFSCDD IGGPIVGGHL QLSGVTIESS  60
VNGGETSISS SPLELESELI ENAMQDIEVK ADLCVPSDDL ADLEWLSSFV EDSFTAVDTP  120
EIFSRYGDFP SAINNSGELT PNMKLSNAYQ PYQKSSPTSV LETSTTSSEF TGPDYRDVSV  180
PGRARSKRSR TGVKTWTTRI LSTSSSVNSL ESMGADSYSL SYSPIMSSED GSGDSTVDAG  240
EQDDEDSQGS KRCKTNNGGQ SQNQSKNSVS TNANSNGNSK GRKKNQDNSQ PWRCMHCQTQ  300
RTPQWRTGPM GPKTLCNACG VRYKSGRLLP EYRPAGSPTY EASRHSHSHK KVLEMRRERE  360
LRMQQPGGHA VQQQGVHGPA ALREKTNNIE AGVKGSSGEY VKSDYGSYGS KCLESMKARL  420
SQPMDLPRPR KNELPKYPSN ASGLEFSTCL TSTTAVLGSR VDFGVDDKSI REMREL*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ppa.122290.0protonema
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00048PBMTransfer from AT4G32890Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024385915.10.0GATA transcription factor 9-like
TrEMBLA0A2K1K0360.0A0A2K1K036_PHYPA; Uncharacterized protein
STRINGPP1S32_226V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP6817287
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32890.13e-45GATA transcription factor 9