PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016652841.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 129aa    MW: 14764 Da    PI: 10.1847
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016652841.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM133.81.2e-41151291115
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGf+FhP+deel+v+yL++kv +++l++ + i+e+d+yk++Pw+Lp+++  +e+ewyfFs+rd+ky++g r+nra++sgyWka  +dk++l++
  XP_016652841.1  15 LPPGFKFHPSDEELIVHYLRNKVISHPLPA-QLITEIDLYKYNPWELPNNALFGEDEWYFFSPRDRKYPNGVRPNRAAASGYWKAASSDKPILTS 108
                     79****************************.89***************87778999************************************998 PP

             NAM  96 .kgelvglkktLvfykgrapk 115
                      + + +g+kk Lvfy+grapk
  XP_016652841.1 109 rGLKRIGVKKALVFYTGRAPK 129
                     56677*************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-4711129IPR003441NAC domain
PROSITE profilePS5100546.69315129IPR003441NAC domain
PfamPF023656.0E-2116125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
MEKVSTFPSS ALQLLPPGFK FHPSDEELIV HYLRNKVISH PLPAQLITEI DLYKYNPWEL  60
PNNALFGEDE WYFFSPRDRK YPNGVRPNRA AASGYWKAAS SDKPILTSRG LKRIGVKKAL  120
VFYTGRAPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A8e-531512920132NAC domain-containing protein 19
3swm_B8e-531512920132NAC domain-containing protein 19
3swm_C8e-531512920132NAC domain-containing protein 19
3swm_D8e-531512920132NAC domain-containing protein 19
3swp_A8e-531512920132NAC domain-containing protein 19
3swp_B8e-531512920132NAC domain-containing protein 19
3swp_C8e-531512920132NAC domain-containing protein 19
3swp_D8e-531512920132NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor of the NAC family associated with the grain protein content (GPC). Accelerates senescence and increases nutrient remobilization from leaves to developing grains. The tetraploid cultivated wheat (T.durum) contains one additional gene coding for a functional protein (NAM-A1) and one extra pseudogene (NAM-B1) (PubMed:17124321). Plays a weaker role in terminal senescence than NAM-A1. {ECO:0000269|PubMed:17124321, ECO:0000269|PubMed:22278768}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016652841.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016652841.12e-91PREDICTED: NAC transcription factor 56-like
SwissprotA0SPJ63e-56NAMB2_TRITD; NAC transcription factor NAM-B2
TrEMBLM5W7333e-85M5W733_PRUPE; Uncharacterized protein
STRINGEMJ091365e-86(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-58NAC domain containing protein 25
Publications ? help Back to Top
  1. Uauy C,Distelfeld A,Fahima T,Blechl A,Dubcovsky J
    A NAC Gene regulating senescence improves grain protein, zinc, and iron content in wheat.
    Science, 2006. 314(5803): p. 1298-301
    [PMID:17124321]