PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016652586.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family M-type_MADS
Protein Properties Length: 187aa    MW: 20774.8 Da    PI: 10.3199
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016652586.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.11.7e-211053245
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgk 45
                     ++++s rqvtfskRr+g++KKA+EL +LC+ae+ +i+fs+ gk
  XP_016652586.1 10 MVKDSSSRQVTFSKRRTGLFKKANELATLCGAEIGLIVFSPGGK 53
                    6799*************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.9E-36160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006626.857161IPR002100Transcription factor, MADS-box
CDDcd002651.76E-34275No hitNo description
SuperFamilySSF554551.09E-28276IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-20323IPR002100Transcription factor, MADS-box
PfamPF003195.6E-251157IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-202338IPR002100Transcription factor, MADS-box
PRINTSPR004041.3E-203859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MGRRKIEMKM VKDSSSRQVT FSKRRTGLFK KANELATLCG AEIGLIVFSP GGKPFSFGHP  60
NVESIADRFL NQEGSKSKAG SSNSKNDETV ERLSQQLDDL NKKLEAEKKR GHMLDKAILK  120
AKGLPLKSKA PNVRELSQAD LQKMKESLEQ LREKVKARAC EMEASSSLLL LANEPDVETD  180
RTVAKNE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6byy_A4e-16192190MEF2 CHIMERA
6byy_B4e-16192190MEF2 CHIMERA
6byy_C4e-16192190MEF2 CHIMERA
6byy_D4e-16192190MEF2 CHIMERA
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016652586.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKP3475520.0KP347552.1 Prunus pseudocerasus MADS-box protein MADS2 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016652586.11e-133PREDICTED: agamous-like MADS-box protein AGL29
TrEMBLM5WKM51e-130M5WKM5_PRUPE; MADS-box protein 38
STRINGEMJ143471e-131(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24242979
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34440.11e-42AGAMOUS-like 29