PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016652251.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family MYB_related
Protein Properties Length: 769aa    MW: 83937 Da    PI: 6.2185
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016652251.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-162468147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r rWT+eE+ +++da k++G   W +I +++g ++t+ q++s+ qk+
   XP_016652251.1 24 RERWTEEEHNRFLDALKLYGRA-WQRIEEHIG-TKTAVQIRSHAQKF 68
                     78******************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.22E-171874IPR009057Homeodomain-like
PROSITE profilePS5129420.7451973IPR017930Myb domain
TIGRFAMsTIGR015579.8E-172271IPR006447Myb domain, plants
SMARTSM007171.1E-122371IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-82464IPR009057Homeodomain-like
PfamPF002494.3E-132467IPR001005SANT/Myb domain
CDDcd001672.30E-92669No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 769 aa     Download sequence    Send to blast
MDTQSSGEDL VIKARKPYTI TKQRERWTEE EHNRFLDALK LYGRAWQRIE EHIGTKTAVQ  60
IRSHAQKFFS KLEKEAHDKG VPAGQSIDID IPPPRPKRKP SNPYPRKSCS AASTWATSHV  120
AAKDGKLLSS TSSSHCKQVV DLEKEPLDER PIKEENPRNG KENQDENCSE VLTMLLEDHC  180
SSVSSANKNS IPTQVALRNA RTFREFVPSL KEVISQDVTN DSYVTTELNG NQNLKKNDAK  240
KIVQDNGTSG ASESENTNAF HKKLVQGEKA DYLNCALPTD GMQGTQTYPR NVPVHVLDGS  300
LGACNQITPA DMSFADTAFH PMGRVHGQPN LFANPTASTT TEHESNASRS SVHQSFPAFH  360
PPFTPLHHGQ KDYQSFLHMS STFSSLIVSS LLQNPAAHAA ASFAATFWPC ANAENTEDSP  420
ACPPGGFLSR QMNSPPSMAA IAAATVAAAS AWWASHGLLP LCAPVQTAFS CPPESMTGVP  480
SMDIGEAPAA NIERGENSLQ IPSLQDQQVD PEHLEAVEAQ DPASKSPSVS SSHSDNGGAE  540
PNIVLKAAAD EKVVASTEEV NDSNNAKSRK QVDRSSCGSN TPSSSEVETD ALEKQEKGKE  600
ELKEPDLNHP ASDSTYRRSR SIINISDPWK EVSEEGRMAF QALFSREVLP QSFSPPPKDK  660
EHQTTTKEGK QNVEDKGEDA SLLDLNKKTW VPFSCHPEVE KNVSPVGDNN AEGLLTIGLS  720
QGKLKARRTG FKPYKRCSVE ANENRAANSI SHCEEKGPKR LRLEGEAQN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016652251.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016652251.10.0PREDICTED: protein LHY isoform X1
RefseqXP_016652252.10.0PREDICTED: protein LHY isoform X1
TrEMBLM5XF420.0M5XF42_PRUPE; Uncharacterized protein
STRINGXP_008244199.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF48602537
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.41e-111MYB_related family protein