PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016652124.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family EIL
Protein Properties Length: 601aa    MW: 67310.1 Da    PI: 5.2633
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016652124.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3444.49.5e-136373871324
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraWW 95 
                     eel+krmwkd+++lkrlke++kq+le+++a ++++k +++++qarrkkmsraQDgiLkYMlk mevc+a+GfvYgiipekgkpv+gasd++raWW
  XP_016652124.1  37 EELEKRMWKDRIKLKRLKEKEKQKLEAQQA-AEKQKPKQTSDQARRKKMSRAQDGILKYMLKLMEVCKARGFVYGIIPEKGKPVSGASDNIRAWW 130
                     8************************99998.99************************************************************** PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT- CS
            EIN3  96 kekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskdq 190
                     kekv+fd+ngpaai+ky+ +++++s+++++  ++ ++++ l++lqD+tlgSLLs+lmqhcdppqr++plekg +pPWWPtG+e+ww++lgl+  q
  XP_016652124.1 131 KEKVKFDKNGPAAIAKYEEECIAMSDADNS--RNGNSQSILQDLQDATLGSLLSSLMQHCDPPQRKYPLEKGNPPPWWPTGNEDWWPKLGLPYGQ 223
                     ******************999999988888..78999999******************************************************* PP

                     -.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXXXX........XXXXXXXXXXXX CS
            EIN3 191 gtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsahss........slrkqspkvtls 277
                     + ppykkphdlkk+wkv+vLtavikhmsp+i++ir+++rqsk+lqdkm+akes+++l vl++ee+++++ s+++         +++++ ++  +s
  XP_016652124.1 224 S-PPYKKPHDLKKMWKVGVLTAVIKHMSPDIAKIRRHVRQSKCLQDKMTAKESAIWLGVLSREESLIRQPSSDNGtsgitetpQSSRGGKQAAVS 317
                     9.9**********************************************************************444568777766669999999* PP

                     XXXXXXXXXXXXXX.XXXXXXXXXX.......................XXXXXXXXXXXXXXXXXXXXX. CS
            EIN3 278 ceqkedvegkkeskikhvqavktta.......................gfpvvrkrkkkpsesakvsske 324
                     +++++dv+g+++   + ++++++++                       + + + +rk+++++ + v++  
  XP_016652124.1 318 SNSDYDVDGTDDGVGSVSSKDDRRNqpmdlepssnlcnntlnhvqdkeQSEKQPRRKRPRVRASPVEQLP 387
                     ********888888888888888878999********888877777777777777777776666665543 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048733.5E-12737286No hitNo description
Gene3DG3DSA:1.10.3180.101.5E-71161294IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167687.06E-62167289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042762Biological Processregulation of sulfur metabolic process
GO:0071281Biological Processcellular response to iron ion
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 601 aa     Download sequence    Send to blast
MGDVEEIGPD ISSDIEEDLR CENIADKDVS DEEIEAEELE KRMWKDRIKL KRLKEKEKQK  60
LEAQQAAEKQ KPKQTSDQAR RKKMSRAQDG ILKYMLKLME VCKARGFVYG IIPEKGKPVS  120
GASDNIRAWW KEKVKFDKNG PAAIAKYEEE CIAMSDADNS RNGNSQSILQ DLQDATLGSL  180
LSSLMQHCDP PQRKYPLEKG NPPPWWPTGN EDWWPKLGLP YGQSPPYKKP HDLKKMWKVG  240
VLTAVIKHMS PDIAKIRRHV RQSKCLQDKM TAKESAIWLG VLSREESLIR QPSSDNGTSG  300
ITETPQSSRG GKQAAVSSNS DYDVDGTDDG VGSVSSKDDR RNQPMDLEPS SNLCNNTLNH  360
VQDKEQSEKQ PRRKRPRVRA SPVEQLPAPS HNENIHLGPR NALPDINHTD VQMTGFQVHD  420
NQQENGTITT LRPLEKDLDI QAQLPASEFN YYSAVPSDNV ISTQGMHVGG TPMLYHGVQD  480
AEVHCGDTFN VYNPSAEYPP SHDQPPSQIV MNEPQIRPAD GVHIPTVHRN GSEIAGGDLP  540
YYVKDTFQSE QDRTVNANFG SPIDSLSLDY GLFNSPFHFG IDGSGSLDDL ELEEMMEYFA  600
A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A7e-761662979140ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that may be involved in the ethylene response pathway. {ECO:0000269|PubMed:9215635, ECO:0000269|PubMed:9851977}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00233DAPTransfer from AT1G73730Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016652124.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0310650.0EF031065.1 Prunus persica EIL1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008243598.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_016652123.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_016652124.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231160.0EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLM5WRR10.0M5WRR1_PRUPE; Uncharacterized protein
STRINGXP_008243598.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-171ETHYLENE-INSENSITIVE3-like 3
Publications ? help Back to Top
  1. Frerigmann H,Gigolashvili T
    Update on the role of R2R3-MYBs in the regulation of glucosinolates upon sulfur deficiency.
    Front Plant Sci, 2014. 5: p. 626
    [PMID:25426131]
  2. Zheng ZL,Zhang B,Leustek T
    Transceptors at the boundary of nutrient transporters and receptors: a new role for Arabidopsis SULTR1;2 in sulfur sensing.
    Front Plant Sci, 2014. 5: p. 710
    [PMID:25566284]
  3. Panda SK,Sunkar R
    Nutrient- and other stress-responsive microRNAs in plants: Role for thiol-based redox signaling.
    Plant Signal Behav, 2015. 10(4): p. e1010916
    [PMID:25912823]
  4. WawrzyƄska A,Sirko A
    EIN3 interferes with the sulfur deficiency signaling in Arabidopsis thaliana through direct interaction with the SLIM1 transcription factor.
    Plant Sci., 2016. 253: p. 50-57
    [PMID:27968996]