PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016651478.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 678aa    MW: 78124.2 Da    PI: 6.8372
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016651478.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR160.26.6e-1942125490
            FAR1   4 neYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     n+YA + GFs+rk + ++ ++n+ + +r+f Cskeg++ +e+   e ++ +r  trtgCka ++ + e +g w+++ ++  HnHe+a
  XP_016651478.1  42 NTYAFNKGFSIRKGHLRRDSQNN-VRQREFLCSKEGFQVDEDLC-EAKKVRRLDTRTGCKAVIRFTVE-NGMWKLSYINPVHNHEFA 125
                     89****************97766.****************9998.99999*****************9.***************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.0E-1642125IPR004330FAR1 DNA binding domain
PfamPF105513.0E-24246341IPR018289MULE transposase domain
PROSITE profilePS5096610.361526562IPR007527Zinc finger, SWIM-type
PfamPF044346.9E-6535559IPR007527Zinc finger, SWIM-type
SMARTSM005756.3E-4537564IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 678 aa     Download sequence    Send to blast
MDSDFQSKSL EKSDKEALFG ESDELRVGME VSDESEAYQL CNTYAFNKGF SIRKGHLRRD  60
SQNNVRQREF LCSKEGFQVD EDLCEAKKVR RLDTRTGCKA VIRFTVENGM WKLSYINPVH  120
NHEFAKPEER QFLRSGRNIP SVRANILGCK SDGSIRPAKS HSYLGKEFGS DENDGSTNKD  180
LPNCLQRSKD EMIEQNGQSL INYFKHKQME DPNFFYSVQV DQFSRITNYF WRDGRSKLDY  240
DCFGDVVCFE TTFRTNSNLV CSPFLGVNHH WKNISFGCAF LLDESAGSFI WLFETFLESM  300
GNKQPKTIFT DEDKAMEKAK AIETVFPETR HRLCNWQISK NATQHLASHC ADPEFKKHFN  360
KCVLDCFTEV EFQNSWDDMI KMFNLESNSW LKMLYSFREK WCPAFSLDTF SANIGSSQRG  420
ENTNAIFHQV SRKTVDLVSF VQHYEQKTKK MQFTELEEDF RCKNAMPHLR VNSGIFKHAA  480
TEYTVKMYSF FENELMSIFG VRMVEVGNDG NQYIYEAIEE GLQRVYMIQY NSTTSMISCS  540
CKLFESMGLL CRHALKVLDF KNYTSIPTQY IVKRWTKGAK KGIVVSNEFC KSSYRKAKSA  600
QSLRLSELMH EGNNVFNIGS LCDSGTRIVR QKLAETIKLL ESDEETTNML GSLSKVDDQS  660
VRDVLLDNGS VESPSCDG
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016651478.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008241736.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_008241737.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_016651478.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
TrEMBLM5VVL20.0M5VVL2_PRUPE; Uncharacterized protein
STRINGXP_008241736.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-109FAR1-related sequence 5