PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016650852.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family HB-other
Protein Properties Length: 987aa    MW: 109643 Da    PI: 9.2784
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016650852.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox19.22.1e-0670126157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++ ++ ++++F  +  +s++e +eL++  g+t +qV+ +F  +R + +k
  XP_016650852.1  70 KRPRDLLNPKAIKYMQSVFSIKDAISKKESRELSALFGVTGTQVRDFFNSQRSRVRK 126
                     799**************************************************9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.84767127IPR001356Homeobox domain
SMARTSM003898.6E-469131IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.9E-569137IPR009057Homeodomain-like
SuperFamilySSF466891.88E-669130IPR009057Homeodomain-like
CDDcd000869.22E-470126No hitNo description
Gene3DG3DSA:1.20.930.101.4E-5227318IPR017923Transcription factor IIS, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 987 aa     Download sequence    Send to blast
MEDLSEMEIG SSVESVQKFL DSQRQLFHSQ IDQLQKVVVT QCNLTGVNPL SQEMAAGALS  60
VKIDGPFAGK RPRDLLNPKA IKYMQSVFSI KDAISKKESR ELSALFGVTG TQVRDFFNSQ  120
RSRVRKLVQL SREKATRSSE HKELQDGVST SSDPLTPIDP VPLNSVGPSS VEDAPSCSTQ  180
DDALSGLDDL DKHFVDNIFN LMRKEETFSG QVKLMEWILQ IQNSSVLCWF LNTGGVMILA  240
TWLSQAAIEE QTSVLLVILK VLCHLPLHKA LPVHMSAILQ SVNRLRFYRT ADVSNRARVL  300
LSRWSKLLAR IQNMKKPNGM KTSSDSQHEL VMLKQSIDEV MGDESWKSNI DIPEDIFATP  360
FENAENSRRS EASEPLKLLT ASSDESNKKQ ILGVSSSQFR ARRKVQLVEQ PGQKSAGRSV  420
QVTRATPVSK GRPMSADDIQ KAKMRAQFMQ SKYGKSGSSN ENKELKTEGG NKLSTSQASI  480
LPVVPKVPVR LDIEEPKKPV TLLLKERETP NRLETSLAPK LRMDLKESIL EKCQRIRVPW  540
KTPPEIKLDP EWRVGGGENG KEIEVQRNRN RREKETIYQR VQEIPSNPKE PWDIEMDYDD  600
SLTPDIPIEQ PPDADGTETQ ASLSREGNNA QAWVASSQGV NSAASLAPAL SQMNGASAAA  660
EPDLELLAVL LKNPELVFAL TSGQAANLSS EDTVKLLDMI KSGGAGNLNG LGRKMEQRVE  720
VSLPSPTPSS NPGTNSQSGW RADAGWNAFP QQMATTNKSL VSSAVRMIPS QRLSTSQPAV  780
PSYSPDYFPP SMQTPAASEM VLTMKNTHLN NLSNSYNVAE RQPNSFPPPL VTTPARQQRQ  840
PQPLQQSRFS EPRLPTHMYP SKPQMGKPGP PPPSPSDSWR ARQDVPSNYR YLENQNQYNA  900
SYGGPSQQPQ LLPGPSWEGN ERVGGNQDFE SWSPDNSPTR NPGYMYGREP RMNTARDYMP  960
DRSRQMNPSG YGGQNRLGNR WPDRGRQ
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016650852.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016650852.10.0PREDICTED: homeobox protein LUMINIDEPENDENS isoform X1
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A251N3G30.0A0A251N3G3_PRUPE; Uncharacterized protein
STRINGXP_008235014.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein
Publications ? help Back to Top
  1. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]