PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016650699.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 709aa    MW: 80328.2 Da    PI: 5.8835
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016650699.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS375.75.8e-1153367072374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                      +lL++cA+av+s d + a++lL+++++++sp+gd++qRla+yf+ +L+arla+  +  y+ l + + s    +e l+a+++++  sP+ ++s++
  XP_016650699.1 336 STLLTQCAQAVASYDRRTASELLKQIRQHSSPYGDATQRLAHYFADGLEARLAGARTPSYSPLVSMQIS---AAEILKAHEVYVTSSPFKNMSNF 427
                     579***************************************************999999999999998...9********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrledl 189
                     +aN++Il+ +e+++r+H+iDf+is+G+QWp++++ L++R +gpp+lRiT+++ p++g   +e++eetg+rL+k+Ae+++vpfe+nv +a+++e++
  XP_016650699.1 428 MANSTILKLAEKATRLHVIDFGISYGFQWPCFIHRLSERLGGPPMLRITAIELPQPGfrPTERVEETGRRLKKYAERFNVPFEYNV-IAQKWETI 521
                     ********************************************************9****************************9.7******* PP

            GRAS 190 eleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++e+L+++++E+++Vn++ +l++++de+v ++s+rd vLkl+k+++P+++++   +  +ns+ F++rf eal ++salfd++ea++p+e+e r  
  XP_016650699.1 522 QFEDLKIDRNEVIVVNCMNRLKHIPDETVMVNSPRDIVLKLIKKINPDLFIHGVVNGTYNSPFFVTRFREALFHFSALFDMFEASVPHEDERRLL 616
                     *********************************************************************************************** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      E++  gr+i nvvaceg er+er et+++W+ r  +aGFk++pl+++  k +k++l+ ++  + ++++e+ +++++gWk+r   ++S+W+
  XP_016650699.1 617 FEKAQYGRDILNVVACEGLERVERPETYKQWQVRNVRAGFKQLPLDQELLKRVKRMLKFMGyHNDFSIDEDGHWMLQGWKGRITRALSFWK 707
                     **********************************************************9999999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098565.701309686IPR005202Transcription factor GRAS
PfamPF035142.0E-112336707IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 709 aa     Download sequence    Send to blast
MDTLLERYSL SMERFNFGHG SASLYSNQNL VNGFHVNQES TSPVLLSTNL DHPSDSSTSL  60
SSGSDGDTID FSDYNHPVLK YVSDILLEED LEGKTCMLQD CLALQAAEKS FYDVLNQEDP  120
PSPNQLPLSV HQSFENSDDD SPHSCHRSNG SIAAKTDWVF DPSETSNAQS SLVQSLSDAG  180
LVSDSLSEMH SLGHSGGLVE ASKFLPNVKL EGNRLMPPGL DQWPSSTNIL MTTPDNDGYN  240
STNELKGKKN HQREDADYPE EGRSNKQPVA FADDSEPQEM FDEVLLCHGN REFESCSPDE  300
SLISEGSGKL QRNKQKGSKT ARSKKQNNNW ELVDLSTLLT QCAQAVASYD RRTASELLKQ  360
IRQHSSPYGD ATQRLAHYFA DGLEARLAGA RTPSYSPLVS MQISAAEILK AHEVYVTSSP  420
FKNMSNFMAN STILKLAEKA TRLHVIDFGI SYGFQWPCFI HRLSERLGGP PMLRITAIEL  480
PQPGFRPTER VEETGRRLKK YAERFNVPFE YNVIAQKWET IQFEDLKIDR NEVIVVNCMN  540
RLKHIPDETV MVNSPRDIVL KLIKKINPDL FIHGVVNGTY NSPFFVTRFR EALFHFSALF  600
DMFEASVPHE DERRLLFEKA QYGRDILNVV ACEGLERVER PETYKQWQVR NVRAGFKQLP  660
LDQELLKRVK RMLKFMGYHN DFSIDEDGHW MLQGWKGRIT RALSFWKKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-383397078375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008223833.10.0PREDICTED: uncharacterized protein LOC103323607
SwissprotQ9XE580.0SCL14_ARATH; Scarecrow-like protein 14
TrEMBLM5WFN10.0M5WFN1_PRUPE; Uncharacterized protein
STRINGPOPTR_0009s03850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13134339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07530.10.0SCARECROW-like 14