PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016650249.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family GRAS
Protein Properties Length: 707aa    MW: 77880.3 Da    PI: 5.8424
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016650249.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS326.84.1e-1003487062374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +++L+++Ae +++g+ +laq +Larl+++ sp g+p+qR+a+yf+eAL+  l+   ++  ++ + s+    + + ++ a+k fse+sP+l+f+++
  XP_016650249.1 348 IDQLFNAAELIETGNPALAQGILARLNHQLSPIGKPFQRAAFYFKEALQLLLHI-NTSSNSSNALSPF---SLIFKIGAYKSFSEISPVLQFANF 438
                     689***********************************************9998.3333333444444...49********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                     t+NqaIleaveg +rvH+iDfdi++G+QW++++q++a R+ g+ps++iT++ s++++++ e+  t+e+L++fA+el+++fe +++  ++l+    
  XP_016650249.1 439 TCNQAILEAVEGFNRVHVIDFDIGYGGQWASFMQEIALRNCGAPSFKITAFISSSTHDEFEIGFTRENLKHFASELNLSFELELVSLEALN-SGS 532
                     *****************************************************9*9***************************97444444.446 PP

            GRAS 192 eeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvE 286
                     + L ++  E +aV + l + ++ ++++sl+      L +vk+lsPk+vv  ++ +d+++ +F++++++al+ ys l++sl+a    + ++ +k+E
  XP_016650249.1 533 WGLPLHVSEGVAVAVNLPIGSFSNNPLSLTM----ALGFVKQLSPKIVVSLDRGSDRTDVPFAHQVIQALHSYSGLLESLDAV-NVNPDALQKIE 622
                     7776666777777777777888889999999....*********************************************665.34668999*** PP

            GRAS 287 rellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     r ll++ i+++v+ ++ +     ++   Wr  ++++GF+p+++s+++++qa++l++++++ g+++e+++ slvl+W+++ L+svS+Wr
  XP_016650249.1 623 RYLLQPGIEKIVTGRHLS----PKRTPPWRTLFSSSGFSPLTFSNFTESQAECLVQRTPVGGFHIEKRQSSLVLCWQRKDLISVSVWR 706
                     *************99998....9999*************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098546.315321686IPR005202Transcription factor GRAS
PfamPF035141.4E-97348706IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 707 aa     Download sequence    Send to blast
MKAMPLPFEQ FQGKGVLDFS SSTSDSQPPQ NQHLHHHHNQ QQQQQKWNQN SNKENCYVGS  60
TEPTSVLDTR RSPSPPTSSS TLSAAAGGGD GGGGGGSGST DTTTCLGTTA AAVYENISQT  120
PLEESKCGPA LGMEDWESVL SESPGQEQSI LRLIMSDIED PSLGLNKLLQ SGSGSDQQDL  180
EFSAGFHDVV DQGGYDGFEP NTGNLQQQQH MGMDEKPQIF NPQMVMNQNQ AQFTQNPALF  240
MPLTYTQLQE HHLLSPPPPK RLNSGGFGPN YPVQRAPFSN PGQELLVRAQ QQHQHQQQQQ  300
QQLQFLPQHL QQQRPTMLVK ENMLSPAEGT KEMMNQNQNQ QQLQQAAIDQ LFNAAELIET  360
GNPALAQGIL ARLNHQLSPI GKPFQRAAFY FKEALQLLLH INTSSNSSNA LSPFSLIFKI  420
GAYKSFSEIS PVLQFANFTC NQAILEAVEG FNRVHVIDFD IGYGGQWASF MQEIALRNCG  480
APSFKITAFI SSSTHDEFEI GFTRENLKHF ASELNLSFEL ELVSLEALNS GSWGLPLHVS  540
EGVAVAVNLP IGSFSNNPLS LTMALGFVKQ LSPKIVVSLD RGSDRTDVPF AHQVIQALHS  600
YSGLLESLDA VNVNPDALQK IERYLLQPGI EKIVTGRHLS PKRTPPWRTL FSSSGFSPLT  660
FSNFTESQAE CLVQRTPVGG FHIEKRQSSL VLCWQRKDLI SVSVWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A3e-3036270618375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008341645.10.0PREDICTED: scarecrow-like protein 22
SwissprotO813161e-145SCL6_ARATH; Scarecrow-like protein 6
TrEMBLM5X7H70.0M5X7H7_PRUPE; Uncharacterized protein
STRINGVIT_15s0048g00270.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF31833170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-140GRAS family protein