PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016650150.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family NAC
Protein Properties Length: 623aa    MW: 68120 Da    PI: 6.1685
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016650150.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM165.22.3e-51281551128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     l+pGfrFhPtdeelv +yLk+kv +k++++ ++i+evdiyk+ePwdL  k ++k++++e+yfFs  d+ky +g r nrat+ gyWkatg+d++v+
  XP_016650150.1  28 LAPGFRFHPTDEELVIYYLKRKVCRKPFKF-NAISEVDIYKSEPWDLAdKsSLKSRDQEYYFFSALDRKYGNGARMNRATNLGYWKATGNDRAVK 121
                     579**************************9.89**************75347888999************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     + ++ +vg+kktLvf++grap+g++t+Wvmheyrl
  XP_016650150.1 122 H-NDITVGMKKTLVFHSGRAPDGKRTNWVMHEYRL 155
                     *.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.4E-5826180IPR003441NAC domain
PROSITE profilePS5100555.60628180IPR003441NAC domain
PfamPF023655.8E-2630155IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009555Biological Processpollen development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005730Cellular Componentnucleolus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 623 aa     Download sequence    Send to blast
MGREAEQPKA IVLAATAPVT PPPAPTALAP GFRFHPTDEE LVIYYLKRKV CRKPFKFNAI  60
SEVDIYKSEP WDLADKSSLK SRDQEYYFFS ALDRKYGNGA RMNRATNLGY WKATGNDRAV  120
KHNDITVGMK KTLVFHSGRA PDGKRTNWVM HEYRLVDEVF EKAGLGSIQD AFVLCRVFHK  180
SNIGPPNGHR YAPFVEEEWD DDDKLTLVPG QESRNEAVAG RDAFIIGNGH AACNDQNAHA  240
ARSEQNAHAA RSEQSGHAAR REQNGHAACI EGNDHAACNG ENGHGTSVQG NGHGTSVQGN  300
GRGTSVQENG HGTSVQGNGH GTSIKGNGHA TSFEGNDHGA SVKGNGHGTS VKENGHGTSV  360
KGNGHLTSVE GNGHGIIIGD DHGTTNEGNC LEMVEYGPDM HNAGNNFEQD TQPISNALVT  420
DGELPTENEN DLPLCKTERM DDYPMTCVVN REERLDDYPS PGPDDAQPLL SLFNRHPGQL  480
RQYKRRRHND SNSNHSNASD ISSGMTHDPC SSTTTTASTE ASMTTTTRNF LSALVEYQLL  540
ESLEPKDTTP PPPPEFSAAL LHSSVPPSCL KYVETLQNEI HKISIERETL KFEMMSAQAM  600
INILQARIDL LNKENEDLKR NNV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-462018212170NAC domain-containing protein 19
3swm_B2e-462018212170NAC domain-containing protein 19
3swm_C2e-462018212170NAC domain-containing protein 19
3swm_D2e-462018212170NAC domain-containing protein 19
3swp_A2e-462018212170NAC domain-containing protein 19
3swp_B2e-462018212170NAC domain-containing protein 19
3swp_C2e-462018212170NAC domain-containing protein 19
3swp_D2e-462018212170NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC050 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). Regulates siRNA-dependent post-transcriptional gene silencing (PTGS) through SGS3 expression modulation (PubMed:28207953). Required during pollen development (PubMed:19237690). {ECO:0000269|PubMed:19237690, ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990, ECO:0000269|PubMed:28207953}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00612ChIP-seqTransfer from AT3G10490Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016650150.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by type III effector proteins (TTEs) secreted by the pathogenic bacteria P.syringae pv. tomato DC3000 during basal defense. {ECO:0000269|PubMed:16553893}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016650150.10.0PREDICTED: uncharacterized protein LOC103331477 isoform X2
SwissprotQ9SQY01e-95NAC52_ARATH; NAC domain containing protein 52
TrEMBLA0A251QDI50.0A0A251QDI5_PRUPE; Uncharacterized protein
STRINGXP_008232317.10.0(Prunus mume)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10490.15e-93NAC domain containing protein 52
Publications ? help Back to Top
  1. Higgins JD,Ferdous M,Osman K,Franklin FC
    The RecQ helicase AtRECQ4A is required to remove inter-chromosomal telomeric connections that arise during meiotic recombination in Arabidopsis.
    Plant J., 2011. 65(3): p. 492-502
    [PMID:21265901]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]
  4. Butel N,Le Masson I,Bouteiller N,Vaucheret H,Elmayan T
    sgs1: a neomorphic nac52 allele impairing post-transcriptional gene silencing through SGS3 downregulation.
    Plant J., 2017. 90(3): p. 505-519
    [PMID:28207953]
  5. Elmayan T, et al.
    Arabidopsis mutants impaired in cosuppression.
    Plant Cell, 1998. 10(10): p. 1747-58
    [PMID:9761800]