PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016649472.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family FAR1
Protein Properties Length: 843aa    MW: 97849.9 Da    PI: 6.4529
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016649472.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR1736.5e-23164250290
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     +Y++YA   GFs+rk+  +ks+ ng +++r+++C+++g+r  ++++  + r++r+etrtgC a++++ ++ +gk++vt++e eHnHe++
  XP_016649472.1 164 CYSRYAVLEGFSIRKDFVNKSRINGIVVSRRYTCYRQGYRPIQHNA--NVRKSRQETRTGCLAHMTIARQPNGKFCVTHFEPEHNHEFV 250
                     7*****************************************9988..9999**********************************986 PP

2FAR191.51.1e-28298386190
            FAR1   1 kfYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90 
                     +fYn+YA +vGFsvrk++ ++sk ng++++r+f+C +eg+r+++k++  + +r+r+etr+gC a+l+++++ d++++vt++e++HnHel+
  XP_016649472.1 298 EFYNTYAGRVGFSVRKDYVNRSKINGSVVSRRFTCFREGFRQRDKRD-MNVKRPRKETRIGCLAQLVISRQPDDRYRVTHFEEKHNHELV 386
                     6*******************************************999.99**************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031011.1E-20164250IPR004330FAR1 DNA binding domain
PfamPF031014.2E-26298386IPR004330FAR1 DNA binding domain
PfamPF105514.0E-31508602IPR018289MULE transposase domain
PfamPF044346.6E-5777823IPR007527Zinc finger, SWIM-type
PROSITE profilePS509669.854788824IPR007527Zinc finger, SWIM-type
SMARTSM005750.0028799826IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 843 aa     Download sequence    Send to blast
MGCSDPDISS HPQEESDYNE LPTSFRLDID VQRDCRSSKD SSAERSQAVI DHEHDFPREC  60
QSPKGSSFEK RLVVIDTEQE YQSPIPSSMD KNQVEIDCKE CETPKFYSVS KFEMDVDGEL  120
ELQSPNVPCA DVPGAGMAMK GEEYIYVVPQ IGVEFESEDH AYNCYSRYAV LEGFSIRKDF  180
VNKSRINGIV VSRRYTCYRQ GYRPIQHNAN VRKSRQETRT GCLAHMTIAR QPNGKFCVTH  240
FEPEHNHEFV APCTTYLLPS QKRLNFAQAV EANLGDKSGI DGVPKLGMGF DSEDHAYEFY  300
NTYAGRVGFS VRKDYVNRSK INGSVVSRRF TCFREGFRQR DKRDMNVKRP RKETRIGCLA  360
QLVISRQPDD RYRVTHFEEK HNHELVAACR VHMLRSQKRL IAAQVFEGDL VDCSNMQPES  420
ASELIRKTGR DSDNHGYDPI DYKNKLPFKC MRGMREGESA RLQQFFQSKQ LKNPSFFYAL  480
QPDVDDQVTN VFWVDTKMAM DYGDFGDVIC FDTTYRLQKD TQPFTPFIGI NHHKQMLIFG  540
AALLYDESVE SYKWLFQTFL EAMSGKKPKT ILTDQDALMA EAIDKVFPET LHRICVWHVY  600
QNALKQLSYM FAGSGSFIND LSSCLFDHED EEDFINAWKV LLDVYGLWEN EWLHEMFEYR  660
EKWATAYGRH IFCADIKAVL LHESFTENLR KYLKSGSDVL LLCKHLGKVI NDWHYKELEG  720
NYNMHHHLPE LMGDVILLKH ARNMYTPMIF ELFQQEYETC LNIIVNQCTQ TGPLFEYKVS  780
IYGQPREYMV TFDSSTETVA CNCMKFEFMG VLCSHALKVL DYRNIKILPS KYILKRWSKD  840
ARV
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016649472.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016649472.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 12-like
TrEMBLA0A2I4E4L00.0A0A2I4E4L0_JUGRE; protein FAR1-RELATED SEQUENCE 5-like
STRINGXP_008230452.10.0(Prunus mume)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF4030530
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.11e-115FAR1-related sequence 5