PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016648871.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 151aa    MW: 17003.2 Da    PI: 6.884
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016648871.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260128.82.4e-4061061101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrrkCa+dCvlapyfp+++p++fa+vhk+FGa n++k+l++lp + re+a+++++yeA +r++dP yG+v++i++lqq+l q+++e+a
  XP_016648871.1   6 RCAGCKFLRRKCAQDCVLAPYFPSSNPERFACVHKIFGAGNITKMLQQLPVHVREAAADCMFYEASVRVEDPTYGCVKIISQLQQDLFQAQSEMA 100
                     6********************************************************************************************** PP

          DUF260  96 llkeel 101
                     ++k+++
  XP_016648871.1 101 KTKAQI 106
                     *99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.1885106IPR004883Lateral organ boundaries, LOB
PfamPF031952.4E-386103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 151 aa     Download sequence    Send to blast
MANPTRCAGC KFLRRKCAQD CVLAPYFPSS NPERFACVHK IFGAGNITKM LQQLPVHVRE  60
AAADCMFYEA SVRVEDPTYG CVKIISQLQQ DLFQAQSEMA KTKAQIAFYN AQQQLNQQQQ  120
NMVDGVDDNY QQDLHSESSR LGLDGHFYSL G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-34710912114LOB family transfactor Ramosa2.1
5ly0_B2e-34710912114LOB family transfactor Ramosa2.1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapXP_016648871.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016648871.11e-111PREDICTED: LOB domain-containing protein 24-like
SwissprotP594681e-43LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A314Y6I01e-95A0A314Y6I0_PRUYE; LOB domain-containing protein 24-like
STRINGEMJ185697e-96(Prunus persica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-44LOB domain-containing protein 24